Gene/Proteome Database (LMPD)
LMPD ID
LMP000646
Gene ID
Species
Mus musculus (Mouse)
Gene Name
glucosaminyl (N-acetyl) transferase 2, I-branching enzyme
Gene Symbol
Synonyms
5330430K10Rik; IGnT; IGnTA; IGnTB; IGnTC
Alternate Names
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; I-branching enzyme; N-acetylglucosaminyltransferase; beta-1,6-N-acetylglucosaminyltransferase; glucosaminyltransferase, I-branching enzyme; large I antigen-forming beta-1,6-N-acetylglucosaminyltransferase
Chromosome
13
Map Location
13 A5|13 20.12 cM
EC Number
2.4.1.150
Proteins
| N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform A | |
|---|---|
| Refseq ID | NP_032131 |
| Protein GI | 39995100 |
| UniProt ID | P97402 |
| mRNA ID | NM_008105 |
| Length | 401 |
| RefSeq Status | VALIDATED |
| MPPSVRYFFIVSVTTVIVFIVLYVLSFGGDQSYQKLNISDSVMLAQVCSSFIDGKSRFLWRNKLMIHEKPSCTEYVTQSHYITAPLSQEEVDFPLAYVMVIHHNFDTFARLFRAIFMPQNIYCVHVDEKATAEFKGAVEQLVSCFPNAFLASKMEPVVYGGISRLQADLNCIKDLSTSEVPWKYAINTCGQDFPLKTNKEIVQYLKGLKGKNLTPGVLPPAHAIGRTRYVHREHLSKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLRDPRAVDLLHWSKDTFSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF | |
| N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform B | |
|---|---|
| Refseq ID | NP_076376 |
| Protein GI | 39995102 |
| UniProt ID | Q6T5E4 |
| mRNA ID | NM_023887 |
| Length | 401 |
| RefSeq Status | VALIDATED |
| MGSWKYSLFSLSLIAALMLMFMYDRKLWKNYHFPRAVSNISVLAEVCLQMFSGESFYTADSARKTTLENFTCPEYKIQNHYITETLSEEEARFPLAFTLTIHKDYDTFERLFRAIYMPQNVYCVHVDSKATDTFKEEVRQLLSCFPNAFLASRMEPVVYGGFSRLQADLNCMKDLVASKIPWKYVLNTCGQDFPLKTNKEIVQYLKRFIGKNLTPGVLPPAHAVGRTKYVHQELLDHKNPYVHNTARLKAPPPHNLTIYFGTAYVALTREFANFVLKDQRSVDLISWSKDTYSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF | |
| N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform C | |
|---|---|
| Refseq ID | NP_573482 |
| Protein GI | 39995104 |
| UniProt ID | Q7TPQ8 |
| mRNA ID | NM_133219 |
| Length | 401 |
| RefSeq Status | VALIDATED |
| MSLRGKVFAVSALSVVIFVVFYHSQLSLPNLYQQLNSSSERTSVTICDYGLQNHTFFTTGDTSPHPLERLSCPQYRIQSHYITSPLSEEEAAFPLAYIMVIHKDFDTFERLFRAIYMPQNVYCVHVDSKATDTFKEAVRQLLSCFPNAFLASKVEQVVYGGFSRLQADLNCMKDLVASKVPWKYVLNTCGQDFPLKTNKEIINHLKRFKGKNITPGVLPPAYIVVRTKYVHQERKGKDGYFMHKTNILKTPPPHQLIIYFGTAYVALTRDFVNFILNDERAIALLEWSKDTYSPDEHFWVTLNRIPGVPGSMPPNASWTGNLRAVKWMDMEAKHGGCHGHYVHGICIYGNGDLQWLINSQSLFANKFELNTYPLTVECLELRLRERTLNQSEIAIQPSWYF | |
Gene Information
Entrez Gene ID
Gene Name
glucosaminyl (N-acetyl) transferase 2, I-branching enzyme
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008109 | IEA:UniProtKB-EC | F | N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity |
| GO:0008375 | IDA:MGI | F | acetylglucosaminyltransferase activity |
| GO:0036438 | IEA:Ensembl | P | maintenance of lens transparency |
| GO:0010812 | IEA:Ensembl | P | negative regulation of cell-substrate adhesion |
| GO:0070374 | IMP:UniProt | P | positive regulation of ERK1 and ERK2 cascade |
| GO:0030335 | IEA:Ensembl | P | positive regulation of cell migration |
| GO:0008284 | IMP:UniProt | P | positive regulation of cell proliferation |
| GO:0010718 | IMP:UniProt | P | positive regulation of epithelial to mesenchymal transition |
| GO:0034116 | IEA:Ensembl | P | positive regulation of heterotypic cell-cell adhesion |
| GO:0051897 | IMP:UniProt | P | positive regulation of protein kinase B signaling |
| GO:0010608 | IMP:UniProt | P | posttranscriptional regulation of gene expression |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
| GO:0007179 | IMP:UniProt | P | transforming growth factor beta receptor signaling pathway |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu00601 | Glycosphingolipid biosynthesis - lacto and neolacto series |
| mmu01100 | Metabolic pathways |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR003406 | Glycosyl transferase, family 14 |
UniProt Annotations
Entry Information
Gene Name
glucosaminyl (N-acetyl) transferase 2, I-branching enzyme
Protein Entry
Q7TPQ8_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-D-glucosamine + beta-D- galactosyl-1,4-N-acetyl-D-glucosaminyl-R = UDP + N-acetyl-beta-D- glucosaminyl-1,6-beta-D-galactosyl-1,4-N-acetyl-D-glucosaminyl-R. |
| Function | Branching enzyme that converts linear into branched poly-N-acetyllactosaminoglycans. Introduces the blood group I antigen during embryonic development. It is closely associated with the development and maturation of erythroid cells. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 14 family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus membrane; Single-pass type II membrane protein. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Gcnt2 - I branching beta-6-GlcNAcT2, variant 1 (IGnT); URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_587"; |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Gcnt2 - I branching beta-6-GlcNAcT2, variant 3 (IGnT); URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_563"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000646 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 39995100 | RefSeq | NP_032131 | 401 | N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform A |
| 39995102 | RefSeq | NP_076376 | 401 | N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform B |
| 39995104 | RefSeq | NP_573482 | 401 | N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform C |
Identical Sequences to LMP000646 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:39995102 | DBBJ | BAE33677.1 | 401 | unnamed protein product [Mus musculus] |
| GI:39995100 | GenBank | AAO86063.1 | 401 | beta-1,6-N-acetylglucosaminyltransferase IGnTA [Mus musculus] |
| GI:39995104 | GenBank | AAO86065.1 | 401 | beta-1,6-N-acetylglucosaminyltransferase IGnTC [Mus musculus] |
| GI:39995104 | GenBank | AAH54845.1 | 401 | Glucosaminyl (N-acetyl) transferase 2, I-branching enzyme [Mus musculus] |
| GI:39995102 | GenBank | AAR95649.1 | 401 | I-branching beta-1,6-acetylglucosaminyltransferase family polypeptide 1 [Mus musculus] |
| GI:39995100 | GenBank | AAR95650.1 | 401 | I-branching beta-1,6-acetylglucosaminyltransferase family polypeptide 2 [Mus musculus] |
| GI:39995104 | GenBank | AAR95651.1 | 401 | I-branching beta-1,6-acetylglucosaminyltransferase family polypeptide 3 [Mus musculus] |
| GI:39995102 | GenBank | AAH94572.1 | 401 | Glucosaminyl (N-acetyl) transferase 2, I-branching enzyme [Mus musculus] |
| GI:39995100 | SwissProt | P97402.2 | 401 | RecName: Full=N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; Short=N-acetylglucosaminyltransferase; AltName: Full=I-branching enzyme; AltName: Full=IGNT; AltName: Full=Large I antigen-forming beta-1,6-N-acetylglucosaminyltransferase [Mus musculus] |
Related Sequences to LMP000646 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:39995102 | DBBJ | BAB03495.1 | 401 | beta-1,6-N-acetylglucosaminyltransferase B [Mus musculus] |
| GI:39995100 | DBBJ | BAB03496.1 | 401 | beta-1,6-N-acetylglucosaminyltransferase A [Mus musculus] |
| GI:39995104 | DBBJ | BAB31918.1 | 356 | unnamed protein product [Mus musculus] |
| GI:39995100 | DBBJ | BAC35697.1 | 401 | unnamed protein product [Mus musculus] |
| GI:39995102 | DBBJ | BAC36889.1 | 401 | unnamed protein product [Mus musculus] |
| GI:39995100 | GenBank | AAB39621.1 | 400 | large I antigen-forming beta-1,6-N-acetylglucosaminyltransferase [Mus musculus] |
| GI:39995102 | GenBank | AAO86064.1 | 401 | beta-1,6-N-acetylglucosaminyltransferase IGnTB [Mus musculus] |
| GI:39995102 | GenBank | AAR95652.1 | 400 | I-branching beta-1,6-acetylglucosaminyltransferase family polypeptide 1 [Rattus norvegicus] |
| GI:39995104 | GenBank | AAR95654.1 | 400 | I-branching beta-1,6-acetylglucosaminyltransferase family polypeptide 3 [Rattus norvegicus] |
| GI:39995104 | GenBank | AAH99796.1 | 400 | Glucosaminyl (N-acetyl) transferase 2, I-branching enzyme [Rattus norvegicus] |
| GI:39995100 | GenBank | EDL40957.1 | 402 | glucosaminyl (N-acetyl) transferase 2, I-branching enzyme, isoform CRA_a, partial [Mus musculus] |
| GI:39995100 | GenBank | EDL98230.1 | 400 | rCG44193, isoform CRA_b [Rattus norvegicus] |
| GI:39995104 | RefSeq | NP_001001511.1 | 400 | N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase [Rattus norvegicus] |
| GI:39995100 | RefSeq | XP_005066422.1 | 400 | PREDICTED: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform C-like isoform X1 [Mesocricetus auratus] |
| GI:39995104 | RefSeq | XP_005066423.1 | 401 | PREDICTED: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform C-like isoform X2 [Mesocricetus auratus] |
| GI:39995104 | RefSeq | XP_006972853.1 | 401 | PREDICTED: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform C isoform X1 [Peromyscus maniculatus bairdii] |
| GI:39995102 | RefSeq | XP_006972854.1 | 400 | PREDICTED: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform C isoform X2 [Peromyscus maniculatus bairdii] |
| GI:39995102 | RefSeq | XP_008260597.1 | 402 | PREDICTED: N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform X1 [Oryctolagus cuniculus] |