Gene/Proteome Database (LMPD)

LMPD ID
LMP000670
Gene ID
13086
Species
Mus musculus (Mouse)
Gene Name
cytochrome P450, family 2, subfamily a, polypeptide 4
Gene Symbol
Cyp2a4
Synonyms
AI893559; Cyp15a1; D7Ucla4
Alternate Names
cytochrome P450 2A4; CYPIIA4; cytochrome P450, 2a4; cytochrome P450-IIA3.1; cytochrome P450-15-alpha; testosterone 15alpha-hydroxylase; testosterone 15-alpha-hydroxylase
Chromosome
7
Map Location
7 A3|7 14.39 cM
EC Number
1.14.14.1

Proteins

cytochrome P450 2A4
Refseq ID NP_034127
Protein GI 116268118
UniProt ID P15392
mRNA ID NM_009997
Length 494
RefSeq Status VALIDATED
MLTSGLLLVAAVAFLSVLVLMSVWKQRKLSGKLPPGPTPLPFVGNFLQLNTEQMYNSLMKISQRYGPVFTIYLGSRRIVVLCGQETVKEALVDQAEEFSGRGEQATFDWLFKGYGIAFSSGERAKQLRRFSITTLRDFGVGKRGIEERIQEEAGFLIDSFRKTNGAFIDPTFYLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSLQFTATSMGQVYEMFSSVMKHLPGPQQQAFKELQGLEDFITKKVEHNQRTLDPNSPRDFIDSFLIRMLEEKKNPNTEFYMKNLVLTTLNLFFAGTETVSTTLRYGFLLLMKYPDIEAKVHEEIDRVIGRNRQPKYEDRMKMPYTEAVIHEIQRFADLIPMGLARRVTKDTKFRDFLLPKGTEVFPMLGSVLKDPKFFSNPKDFNPKHFLDDKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTNIMQNFHFKSTQEPQDIDVSPRLVGFVTIPPTYTMSFLSR

Gene Information

Entrez Gene ID
13086
Gene Name
cytochrome P450, family 2, subfamily a, polypeptide 4
Gene Symbol
Cyp2a4
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0070330 IEA:UniProtKB-EC F aromatase activity
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0035634 IEP:UniProtKB P response to stilbenoid

KEGG Pathway Links

KEGG Pathway ID Description
mmu01100 Metabolic pathways
mmu00830 Retinol metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5893196 Aflatoxin activation and detoxification
5892994 Xenobiotics

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR008067 Cytochrome P450, E-class, group I, CYP2A-like
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 2, subfamily a, polypeptide 4
Protein Entry
CP2A4_MOUSE
UniProt ID
P15392
Species
Mouse

Comments

Comment Type Description
Catalytic Activity RH + reduced flavoprotein + O(2) = ROH + oxidized flavoprotein + H(2)O.
Cofactor Name=heme; Xref=ChEBI:CHEBI:30413; Evidence={ECO:0000250};
Function Highly active in the 15-alpha-hydroxylation of testosterone. Also active in the 15-alpha-hydroxylation of progesterone and androstenedione. Little or no activity on corticosterone, pregnenolone, dehydroepiandrosterone, estradiol or estriol.
Miscellaneous There are only 11 differences between the sequence of testosterone 15-alpha-hydroxylase and that of coumarin 7- hydroxylase. By site-directed mutagenesis it has been shown that modification of position 209 is sufficient to convert the specificity of the two forms of the enzyme.
Similarity Belongs to the cytochrome P450 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Tissue Specificity Kidney and lung. Expressed in liver, with a strong circadian rhythmicity. Circadian expression is regulated by DBP. {ECO:0000269|PubMed:10490589}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000670 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
116268118 RefSeq NP_034127 494 cytochrome P450 2A4

Identical Sequences to LMP000670 proteins

Reference Database Accession Length Protein Name
GI:116268118 GenBank AAH10761.1 494 Cytochrome P450, family 2, subfamily a, polypeptide 4 [Mus musculus]
GI:116268118 GenBank AAH63778.1 494 Cytochrome P450, family 2, subfamily a, polypeptide 4 [Mus musculus]
GI:116268118 SwissProt P15392.3 494 RecName: Full=Cytochrome P450 2A4; AltName: Full=CYPIIA4; AltName: Full=Cytochrome P450-15-alpha; AltName: Full=Cytochrome P450-IIA3.1; AltName: Full=Testosterone 15-alpha-hydroxylase [Mus musculus]

Related Sequences to LMP000670 proteins

Reference Database Accession Length Protein Name
GI:116268118 DBBJ BAE28876.1 494 unnamed protein product [Mus musculus]
GI:116268118 GenBank AAA40426.1 494 testosterone 15-alpha-hydroxylase [Mus musculus]
GI:116268118 GenBank AAA40429.1 494 testosterone 15-alpha-hydroxylase [Mus musculus]
GI:116268118 GenBank AAA37797.1 494 P450-15-alpha hydroxylase I, partial [Mus musculus]
GI:116268118 GenBank AAI38799.1 494 Cytochrome P450, family 2, subfamily a, polypeptide 5 [Mus musculus]
GI:116268118 GenBank AAI38797.1 494 Cytochrome P450, family 2, subfamily a, polypeptide 5 [Mus musculus]