Gene/Proteome Database (LMPD)
LMPD ID
LMP000674
Gene ID
Species
Homo sapiens (Human)
Gene Name
nuclear receptor subfamily 2, group F, member 2
Gene Symbol
Synonyms
ARP1; CHTD4; COUPTFB; COUPTFII; NF-E3; NR2F1; SVP40; TFCOUP2
Chromosome
15
Map Location
15q26
Summary
This gene encodes a member of the steroid thyroid hormone superfamily of nuclear receptors. The encoded protein is a ligand inducible transcription factor that is involved in the regulation of many different genes. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Orthologs
Proteins
| COUP transcription factor 2 isoform a | |
|---|---|
| Refseq ID | NP_066285 |
| Protein GI | 14149746 |
| UniProt ID | P24468 |
| mRNA ID | NM_021005 |
| Length | 414 |
| RefSeq Status | REVIEWED |
| MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ | |
| COUP transcription factor 2 isoform b | |
|---|---|
| Refseq ID | NP_001138627 |
| Protein GI | 223555949 |
| UniProt ID | P24468 |
| mRNA ID | NM_001145155 |
| Length | 281 |
| RefSeq Status | REVIEWED |
| MQAVWDLEQGKYGFAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ | |
| COUP transcription factor 2 isoform c | |
|---|---|
| Refseq ID | NP_001138628 |
| Protein GI | 223555951 |
| UniProt ID | P24468 |
| mRNA ID | NM_001145156 |
| Length | 261 |
| RefSeq Status | REVIEWED |
| MPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ | |
| COUP transcription factor 2 isoform c | |
|---|---|
| Refseq ID | NP_001138629 |
| Protein GI | 223555953 |
| UniProt ID | P24468 |
| mRNA ID | NM_001145157 |
| Length | 261 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:223555951 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
nuclear receptor subfamily 2, group F, member 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IDA:BHF-UCL | C | nucleus |
| GO:0004879 | IDA:UniProtKB | F | ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity |
| GO:0042803 | IPI:UniProtKB | F | protein homodimerization activity |
| GO:0001972 | IDA:UniProtKB | F | retinoic acid binding |
| GO:0043565 | IDA:UniProtKB | F | sequence-specific DNA binding |
| GO:0003700 | IDA:UniProtKB | F | sequence-specific DNA binding transcription factor activity |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0003714 | TAS:ProtInc | F | transcription corepressor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0009952 | IEA:Ensembl | P | anterior/posterior pattern specification |
| GO:0048514 | IEA:Ensembl | P | blood vessel morphogenesis |
| GO:0009566 | IEA:Ensembl | P | fertilization |
| GO:0030900 | IEA:Ensembl | P | forebrain development |
| GO:0030522 | IDA:GOC | P | intracellular receptor signaling pathway |
| GO:0060173 | IEA:Ensembl | P | limb development |
| GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
| GO:0001893 | IEA:Ensembl | P | maternal placenta development |
| GO:0045736 | IDA:BHF-UCL | P | negative regulation of cyclin-dependent protein serine/threonine kinase activity |
| GO:0010596 | IMP:BHF-UCL | P | negative regulation of endothelial cell migration |
| GO:0001937 | IMP:BHF-UCL | P | negative regulation of endothelial cell proliferation |
| GO:0000122 | IDA:UniProtKB | P | negative regulation of transcription from RNA polymerase II promoter |
| GO:0045892 | IDA:BHF-UCL | P | negative regulation of transcription, DNA-templated |
| GO:0001764 | IEA:Ensembl | P | neuron migration |
| GO:0060674 | IEA:Ensembl | P | placenta blood vessel development |
| GO:0045893 | IDA:UniProtKB | P | positive regulation of transcription, DNA-templated |
| GO:0009956 | IEA:Ensembl | P | radial pattern formation |
| GO:0006357 | TAS:ProtInc | P | regulation of transcription from RNA polymerase II promoter |
| GO:0060849 | IMP:BHF-UCL | P | regulation of transcription involved in lymphatic endothelial cell fate commitment |
| GO:0032355 | IEA:Ensembl | P | response to estradiol |
| GO:0007165 | TAS:ProtInc | P | signal transduction |
| GO:0007519 | IEA:Ensembl | P | skeletal muscle tissue development |
| GO:0060707 | IEA:Ensembl | P | trophoblast giant cell differentiation |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_27161 | Transcriptional regulation of white adipocyte differentiation |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Gene Name
nuclear receptor subfamily 2, group F, member 2
Protein Entry
COT2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P24468-1; Sequence=Displayed; Name=2; IsoId=P24468-2; Sequence=VSP_042630; Name=3; IsoId=P24468-3; Sequence=VSP_043897; |
| Disease | Congenital heart defects, multiple types, 4 (CHTD4) [MIM |
| Function | Ligand-activated transcription factor. Activated by high concentrations of 9-cis-retinoic acid and all-trans-retinoic acid, but not by dexamethasone, cortisol or progesterone (in vitro). Regulation of the apolipoprotein A-I gene transcription. Binds to DNA site A. {ECO |
| Similarity | Belongs to the nuclear hormone receptor family. NR2 subfamily. |
| Similarity | Contains 1 nuclear receptor DNA-binding domain. |
| Subcellular Location | Nucleus. |
| Subunit | Interacts with SQSTM1 (By similarity). Binds DNA as a dimer; homodimer or heterodimer with NR2F6. Interacts with NCOA1, NCOA2, NCOA3 and PPARGC1A. Interacts with ZFPM2 (By similarity). |
| Tissue Specificity | Ubiquitous. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000674 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 14149746 | RefSeq | NP_066285 | 414 | COUP transcription factor 2 isoform a |
| 223555949 | RefSeq | NP_001138627 | 281 | COUP transcription factor 2 isoform b |
| 223555951 | RefSeq | NP_001138628 | 261 | COUP transcription factor 2 isoform c |
Identical Sequences to LMP000674 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:14149746 | GenBank | JAB22968.1 | 414 | COUP transcription factor 2 isoform a [Callithrix jacchus] |
| GI:14149746 | GenBank | JAB39973.1 | 414 | COUP transcription factor 2 isoform a [Callithrix jacchus] |
| GI:14149746 | GenBank | JAB39974.1 | 414 | COUP transcription factor 2 isoform a [Callithrix jacchus] |
| GI:14149746 | RefSeq | XP_005560624.1 | 414 | PREDICTED: COUP transcription factor 2 isoform X2 [Macaca fascicularis] |
| GI:14149746 | RefSeq | XP_006984478.1 | 414 | PREDICTED: COUP transcription factor 2-like [Peromyscus maniculatus bairdii] |
| GI:223555951 | RefSeq | XP_008050413.1 | 261 | PREDICTED: COUP transcription factor 2 isoform X2 [Tarsius syrichta] |
| GI:223555951 | RefSeq | XP_008154687.1 | 261 | PREDICTED: COUP transcription factor 2 isoform X2 [Eptesicus fuscus] |
| GI:223555951 | RefSeq | XP_008519606.1 | 261 | PREDICTED: COUP transcription factor 2 [Equus przewalskii] |
| GI:223555949 | RefSeq | XP_008685840.1 | 281 | PREDICTED: COUP transcription factor 2 [Ursus maritimus] |
| GI:223555949 | RefSeq | XP_008850566.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X2 [Nannospalax galili] |
| GI:223555951 | RefSeq | XP_008850567.1 | 261 | PREDICTED: COUP transcription factor 2 isoform X3 [Nannospalax galili] |
| GI:223555949 | RefSeq | XP_008996594.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X2 [Callithrix jacchus] |
| GI:223555951 | RefSeq | XP_008996595.1 | 261 | PREDICTED: COUP transcription factor 2 isoform X3 [Callithrix jacchus] |
| GI:223555949 | RefSeq | XP_009209229.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X2 [Papio anubis] |
| GI:223555951 | RefSeq | XP_009428167.1 | 261 | PREDICTED: COUP transcription factor 2 isoform X2 [Pan troglodytes] |
| GI:14149746 | RefSeq | XP_010359627.1 | 414 | PREDICTED: COUP transcription factor 2 isoform X1 [Rhinopithecus roxellana] |
| GI:223555949 | RefSeq | XP_010359628.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X2 [Rhinopithecus roxellana] |
| GI:223555949 | RefSeq | XP_010606175.1 | 281 | PREDICTED: COUP transcription factor 2 [Fukomys damarensis] |
Related Sequences to LMP000674 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:223555951 | DBBJ | BAE24245.1 | 414 | unnamed protein product [Mus musculus] |
| GI:14149746 | EMBL | CAB55624.1 | 414 | COUP-TFII transcription factor [Bos taurus] |
| GI:223555951 | GenBank | AAB61297.1 | 414 | ovalbumin upstream promoter beta nuclear receptor rCOUPb [Rattus norvegicus] |
| GI:14149746 | GenBank | AAX29860.1 | 415 | nuclear receptor subfamily 2 group F member 2, partial [synthetic construct] |
| GI:14149746 | GenBank | AAI23678.1 | 414 | Nuclear receptor subfamily 2, group F, member 2 [Bos taurus] |
| GI:223555949 | GenBank | AAI34736.1 | 281 | NR2F2 protein [Bos taurus] |
| GI:223555951 | GenBank | EDM08487.1 | 414 | nuclear receptor subfamily 2, group F, member 2, isoform CRA_a [Rattus norvegicus] |
| GI:223555951 | RefSeq | NP_542956.1 | 414 | COUP transcription factor 2 [Rattus norvegicus] |
| GI:14149746 | RefSeq | NP_776827.1 | 414 | COUP transcription factor 2 [Bos taurus] |
| GI:223555951 | RefSeq | XP_003901468.1 | 414 | PREDICTED: COUP transcription factor 2 isoform X1 [Papio anubis] |
| GI:223555949 | RefSeq | XP_004617800.1 | 281 | PREDICTED: COUP transcription factor 2 [Sorex araneus] |
| GI:223555949 | RefSeq | XP_005221767.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X2 [Bos taurus] |
| GI:223555949 | RefSeq | XP_005869977.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X1 [Myotis brandtii] |
| GI:223555949 | RefSeq | XP_006044318.1 | 281 | PREDICTED: COUP transcription factor 2-like [Bubalus bubalis] |
| GI:223555949 | RefSeq | XP_008154686.1 | 281 | PREDICTED: COUP transcription factor 2 isoform X1 [Eptesicus fuscus] |
| GI:223555951 | SwissProt | O09018.1 | 414 | RecName: Full=COUP transcription factor 2; Short=COUP-TF2; AltName: Full=Apolipoprotein A-I regulatory protein 1; Short=ARP-1; AltName: Full=COUP transcription factor II; Short=COUP-TF II; AltName: Full=COUPb; AltName: Full=Nuclear receptor subfamily 2 group F member 2; AltName: Full=Ovalbumin upstream promoter beta nuclear receptor [Rattus norvegicus] |
| GI:14149746 | SwissProt | Q9TTR7.1 | 414 | RecName: Full=COUP transcription factor 2; Short=COUP-TF2; AltName: Full=COUP transcription factor II; Short=COUP-TF II; AltName: Full=Nuclear receptor subfamily 2 group F member 2 [Bos taurus] |
| GI:14149746 | Third Party Genbank | DAA17696.1 | 414 | TPA: COUP transcription factor 2 [Bos taurus] |