Gene/Proteome Database (LMPD)
LMPD ID
LMP000685
Gene ID
Species
Mus musculus (Mouse)
Gene Name
SEC14-like 4 (S. cerevisiae)
Gene Symbol
Synonyms
AI256582; AW536553; SPF; TAP
Alternate Names
SEC14-like protein 4; SEC14-like 2; squalene transfer protein; supernatant protein factor; alpha-tocopherol associated protein
Chromosome
11
Map Location
11 A1|11
Proteins
SEC14-like protein 4 | |
---|---|
Refseq ID | NP_666125 |
Protein GI | 22165368 |
UniProt ID | Q8R0F9 |
mRNA ID | NM_146013 |
Length | 403 |
RefSeq Status | PROVISIONAL |
MRGQVGDLSPQQQEALARFRETLQDLLPTLPKADDYFLLRWLRARNFDLKKSEDMLRKHVEFRNQQNLDQILTWQAPEVIQLYDSGGLSGYDYEGCPVWFDIIGTMDPKGLFMSASKQDMIRKRIKVCEMLLHECELQSQKLGRKIERMVMVFDMEGLSLRHLWKPAVEVYQQFFAILEANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPDQLPVEFGGTMTDPDGNPKCLTKINYGGEVPKRYYLSNQERPQYEHSVVVGRGSSHQVENEILFPGCVLRWQFASDGGDIGFGVFLKTRMGERQKAGEMVEVLPSQRYNAHMVPEDGSLNCLKAGVYVLRFDNTYSLLHTKKVGYTAEVLLPDKACEEKLQGLGSVSPP |
Gene Information
Entrez Gene ID
Gene Name
SEC14-like 4 (S. cerevisiae)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:InterPro | C | integral component of membrane |
GO:0005622 | IEA:InterPro | C | intracellular |
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0005215 | IEA:InterPro | F | transporter activity |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Probable hydrophobic ligand-binding protein; may play a role in the transport of hydrophobic ligands like tocopherol, squalene and phospholipids. {ECO:0000250}. |
Similarity | Contains 1 CRAL-TRIO domain. {ECO:0000255|PROSITE- ProRule:PRU00056}. |
Similarity | Contains 1 GOLD domain. {ECO:0000255|PROSITE- ProRule:PRU00096}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000685 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
22165368 | RefSeq | NP_666125 | 403 | SEC14-like protein 4 |
Identical Sequences to LMP000685 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:22165368 | GenBank | AAH26948.1 | 403 | SEC14-like 4 (S. cerevisiae) [Mus musculus] |
GI:22165368 | GenBank | EDL40454.1 | 403 | mCG9615, isoform CRA_c [Mus musculus] |
GI:22165368 | SwissProt | Q8R0F9.1 | 403 | RecName: Full=SEC14-like protein 4 [Mus musculus] |
Related Sequences to LMP000685 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:22165368 | GenBank | EDM00207.1 | 412 | similar to SEC14 (S. cerevisiae)-like 2 (predicted), isoform CRA_b [Rattus norvegicus] |
GI:22165368 | RefSeq | NP_001102560.1 | 412 | SEC14-like protein 4 [Rattus norvegicus] |
GI:22165368 | RefSeq | XP_003509072.1 | 412 | PREDICTED: SEC14-like protein 4 [Cricetulus griseus] |
GI:22165368 | RefSeq | XP_005366179.1 | 412 | PREDICTED: SEC14-like protein 4 isoform X1 [Microtus ochrogaster] |
GI:22165368 | RefSeq | XP_006973109.1 | 412 | PREDICTED: SEC14-like protein 4 [Peromyscus maniculatus bairdii] |
GI:22165368 | RefSeq | XP_007620395.1 | 412 | PREDICTED: SEC14-like protein 4 [Cricetulus griseus] |