Gene/Proteome Database (LMPD)
LMPD ID
LMP000700
Gene ID
Species
Homo sapiens (Human)
Gene Name
sulfotransferase family 1E, estrogen-preferring, member 1
Gene Symbol
Synonyms
EST; EST-1; ST1E1; STE
Alternate Names
estrogen sulfotransferase; sulfotransferase 1E1; estrone sulfotransferase; sulfotransferase, estrogen-preferring
Chromosome
4
Map Location
4q13.1
EC Number
2.8.2.4
Summary
Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| estrogen sulfotransferase | |
|---|---|
| Refseq ID | NP_005411 |
| Protein GI | 4885617 |
| UniProt ID | P49888 |
| mRNA ID | NM_005420 |
| Length | 294 |
| RefSeq Status | REVIEWED |
| MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI | |
Gene Information
Entrez Gene ID
Gene Name
sulfotransferase family 1E, estrogen-preferring, member 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0004304 | TAS:ProtInc | F | estrone sulfotransferase activity |
| GO:0047894 | IDA:BHF-UCL | F | flavonol 3-sulfotransferase activity |
| GO:0005496 | IEA:UniProtKB-KW | F | steroid binding |
| GO:0050294 | IDA:UniProtKB | F | steroid sulfotransferase activity |
| GO:0050427 | TAS:Reactome | P | 3'-phosphoadenosine 5'-phosphosulfate metabolic process |
| GO:0008210 | IDA:UniProtKB | P | estrogen metabolic process |
| GO:0007565 | IEA:Ensembl | P | female pregnancy |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0008202 | TAS:ProtInc | P | steroid metabolic process |
| GO:0051923 | IDA:BHF-UCL | P | sulfation |
| GO:0006805 | TAS:Reactome | P | xenobiotic metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00140 | Steroid hormone biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
sulfotransferase family 1E, estrogen-preferring, member 1
Protein Entry
ST1E1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 3'-phosphoadenylyl sulfate + estrone = adenosine 3',5'-bisphosphate + estrone 3-sulfate. |
| Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of estradiol and estrone. May play a role in the regulation of estrogen receptor activity by metabolizing free estradiol. Maximally sulfates beta-estradiol and estrone at concentrations of 20 nM. Also sulfates dehydroepiandrosterone, pregnenolone, ethinylestradiol, equalenin, diethylstilbesterol and 1-naphthol, at significantly higher concentrations; however, cortisol, testosterone and dopamine are not sulfated. |
| Similarity | Belongs to the sulfotransferase 1 family. |
| Subcellular Location | Cytoplasm. |
| Subunit | Homodimer. {ECO |
| Tissue Specificity | Liver, intestine and at lower level in the kidney. |
| Web Resource | Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/ste/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000700 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4885617 | RefSeq | NP_005411 | 294 | estrogen sulfotransferase |
Identical Sequences to LMP000700 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4885617 | DBBJ | BAJ20837.1 | 294 | sulfotransferase family 1E, estrogen-preferring, member 1, partial [synthetic construct] |
| GI:4885617 | GenBank | ADS56099.1 | 294 | Sequence 7 from patent US 7803921 |
| GI:4885617 | GenBank | AEF77885.1 | 294 | Sequence 7 from patent US 7943355 |
| GI:4885617 | GenBank | AEK13654.1 | 294 | Sequence 66 from patent US 7972785 |
| GI:4885617 | GenBank | AER79657.1 | 294 | Sequence 7 from patent US 8048662 |
| GI:4885617 | GenBank | AHD78125.1 | 294 | Sequence 25104 from patent US 8586006 |
Related Sequences to LMP000700 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4885617 | GenBank | ACM84830.1 | 309 | Sequence 10328 from patent US 6812339 |
| GI:4885617 | GenBank | JAA14072.1 | 294 | sulfotransferase family 1E, estrogen-preferring, member 1 [Pan troglodytes] |
| GI:4885617 | PDB | 1HY3 | 294 | Chain B, Crystal Structure Of Human Estrogen Sulfotransferase V269e Mutant In The Presence Of Paps |
| GI:4885617 | RefSeq | XP_001161190.1 | 294 | PREDICTED: estrogen sulfotransferase isoform X1 [Pan troglodytes] |
| GI:4885617 | RefSeq | XP_003809061.1 | 294 | PREDICTED: estrogen sulfotransferase [Pan paniscus] |
| GI:4885617 | RefSeq | XP_009446064.1 | 294 | PREDICTED: estrogen sulfotransferase isoform X1 [Pan troglodytes] |