Gene/Proteome Database (LMPD)
LMPD ID
LMP000727
Gene ID
Species
Homo sapiens (Human)
Gene Name
3'(2'), 5'-bisphosphate nucleotidase 1
Gene Symbol
Synonyms
HEL20; PIP
Chromosome
1
Map Location
1q41
EC Number
3.1.3.7
Summary
BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntase's physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
3'(2'),5'-bisphosphate nucleotidase 1 isoform 1 | |
---|---|
Refseq ID | NP_006076 |
Protein GI | 116812595 |
UniProt ID | V9HWF9 |
mRNA ID | NM_006085 |
Length | 308 |
RefSeq Status | VALIDATED |
MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP |
3'(2'),5'-bisphosphate nucleotidase 1 isoform 2 | |
---|---|
Refseq ID | NP_001273080 |
Protein GI | 555290081 |
UniProt ID | O95861 |
mRNA ID | NM_001286151 |
Length | 253 |
RefSeq Status | VALIDATED |
MSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP |
3'(2'),5'-bisphosphate nucleotidase 1 isoform 2 | |
---|---|
Refseq ID | NP_001273078 |
Protein GI | 555290116 |
UniProt ID | O95861 |
mRNA ID | NM_001286149 |
Length | 253 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:555290081 (mRNA isoform) |
3'(2'),5'-bisphosphate nucleotidase 1 isoform 3 | |
---|---|
Refseq ID | NP_001273079 |
Protein GI | 555289990 |
UniProt ID | O95861 |
mRNA ID | NM_001286150 |
Length | 272 |
RefSeq Status | VALIDATED |
MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEELVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLATLRNYDYYASRVPESIKNALVP |
Gene Information
Entrez Gene ID
Gene Name
3'(2'), 5'-bisphosphate nucleotidase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | TAS:Reactome | C | cytosol |
GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
GO:0008441 | TAS:ProtInc | F | 3'(2'),5'-bisphosphate nucleotidase activity |
GO:0004441 | IEA:Ensembl | F | inositol-1,4-bisphosphate 1-phosphatase activity |
GO:0000287 | IEA:Ensembl | F | magnesium ion binding |
GO:0050427 | TAS:Reactome | P | 3'-phosphoadenosine 5'-phosphosulfate metabolic process |
GO:0016311 | TAS:GOC | P | dephosphorylation |
GO:0007399 | TAS:ProtInc | P | nervous system development |
GO:0006139 | TAS:ProtInc | P | nucleobase-containing compound metabolic process |
GO:0046854 | IEA:InterPro | P | phosphatidylinositol phosphorylation |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
GO:0006805 | TAS:Reactome | P | xenobiotic metabolic process |
KEGG Pathway Links
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_6913 | Cytosolic sulfonation of small molecules |
REACT_6959 | Phase II conjugation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
3'(2'), 5'-bisphosphate nucleotidase 1
Protein Entry
BPNT1_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=O95861-1; Sequence=Displayed; Name=2; IsoId=O95861-2; Sequence=VSP_009937; Note=No experimental confirmation available.; Name=3; IsoId=O95861-3; Sequence=VSP_054807; Name=4; IsoId=O95861-4; Sequence=VSP_054808; |
Catalytic Activity | Adenosine 3',5'-bisphosphate + H(2)O = adenosine 5'-phosphate + phosphate. |
Cofactor | Name=Mg(2+); Xref=ChEBI |
Enzyme Regulation | Uncompetitive inhibition by micromolar concentrations of lithium. Competitive inhibition by inositol 1,4- bisphosphate. |
Function | Converts adenosine 3'-phosphate 5'-phosphosulfate (PAPS) to adenosine 5'-phosphosulfate (APS) and 3'(2')-phosphoadenosine 5'- phosphate (PAP) to AMP. Has 1000-fold lower activity towards inositol 1,4-bisphosphate (Ins(1,4)P2) and inositol 1,3,4- trisphosphate (Ins(1,3,4)P3), but does not hydrolyze Ins(1)P, Ins(3,4)P2, Ins(1,3,4,5)P4 or InsP6. |
Similarity | Belongs to the inositol monophosphatase family. |
Tissue Specificity | Highly expressed in kidney, liver, pancreas and heart. Detected at lower levels in brain, placenta, lung and skeletal muscle. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000727 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
116812595 | RefSeq | NP_006076 | 308 | 3'(2'),5'-bisphosphate nucleotidase 1 isoform 1 |
555290081 | RefSeq | NP_001273080 | 253 | 3'(2'),5'-bisphosphate nucleotidase 1 isoform 2 |
555289990 | RefSeq | NP_001273079 | 272 | 3'(2'),5'-bisphosphate nucleotidase 1 isoform 3 |
Identical Sequences to LMP000727 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:555289990 | DBBJ | BAG62441.1 | 272 | unnamed protein product [Homo sapiens] |
GI:555290081 | DBBJ | BAG60687.1 | 253 | unnamed protein product [Homo sapiens] |
GI:116812595 | GenBank | JAA17705.1 | 308 | 3'(2'), 5'-bisphosphate nucleotidase 1 [Pan troglodytes] |
GI:116812595 | GenBank | JAA17706.1 | 308 | 3'(2'), 5'-bisphosphate nucleotidase 1 [Pan troglodytes] |
GI:116812595 | GenBank | JAA25927.1 | 308 | 3'(2'), 5'-bisphosphate nucleotidase 1 [Pan troglodytes] |
GI:116812595 | GenBank | JAA25928.1 | 308 | 3'(2'), 5'-bisphosphate nucleotidase 1 [Pan troglodytes] |
GI:555289990 | RefSeq | XP_002809487.1 | 272 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X2 [Pongo abelii] |
GI:555289990 | RefSeq | XP_003807232.1 | 272 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X4 [Pan paniscus] |
GI:116812595 | RefSeq | XP_005273057.1 | 308 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X3 [Homo sapiens] |
GI:555290081 | RefSeq | NP_001273078.1 | 253 | 3'(2'),5'-bisphosphate nucleotidase 1 isoform 2 [Homo sapiens] |
GI:116812595 | RefSeq | XP_009235846.1 | 308 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X1 [Pongo abelii] |
Related Sequences to LMP000727 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:555290081 | DBBJ | BAF84632.1 | 308 | unnamed protein product [Homo sapiens] |
GI:116812595 | EMBL | CAB65115.1 | 308 | PAP-inositol-1,4-phosphatase [Homo sapiens] |
GI:555290081 | GenBank | EAW93306.1 | 308 | 3'(2'), 5'-bisphosphate nucleotidase 1, isoform CRA_a [Homo sapiens] |
GI:555290081 | GenBank | EAW93308.1 | 308 | 3'(2'), 5'-bisphosphate nucleotidase 1, isoform CRA_a [Homo sapiens] |
GI:116812595 | GenBank | JAA34444.1 | 352 | 3'(2'), 5'-bisphosphate nucleotidase 1 [Pan troglodytes] |
GI:116812595 | RefSeq | XP_001172472.1 | 366 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X3 [Pan troglodytes] |
GI:116812595 | RefSeq | XP_003308798.1 | 352 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X4 [Pan troglodytes] |
GI:555290081 | RefSeq | XP_003807231.1 | 308 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X2 [Pan paniscus] |
GI:555289990 | RefSeq | XP_003949746.1 | 316 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X8 [Pan troglodytes] |
GI:116812595 | RefSeq | XP_004028470.1 | 352 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform 1 [Gorilla gorilla gorilla] |
GI:116812595 | RefSeq | XP_004028471.1 | 367 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform 2 [Gorilla gorilla gorilla] |
GI:555289990 | RefSeq | XP_004028472.1 | 316 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform 3 [Gorilla gorilla gorilla] |
GI:555289990 | RefSeq | XP_006711177.1 | 287 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X9 [Homo sapiens] |
GI:555289990 | RefSeq | XP_008957485.1 | 287 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X3 [Pan paniscus] |
GI:555290081 | RefSeq | XP_009235846.1 | 308 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X1 [Pongo abelii] |
GI:555289990 | RefSeq | XP_009439786.1 | 330 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 isoform X6 [Pan troglodytes] |
GI:555289990 | RefSeq | XP_010339340.1 | 272 | PREDICTED: 3'(2'),5'-bisphosphate nucleotidase 1 [Saimiri boliviensis boliviensis] |
GI:555290081 | SwissProt | O95861.1 | 308 | RecName: Full=3'(2'),5'-bisphosphate nucleotidase 1; AltName: Full=Bisphosphate 3'-nucleotidase 1; AltName: Full=PAP-inositol 1,4-phosphatase; Short=PIP [Homo sapiens] |