Gene/Proteome Database (LMPD)
Proteins
| acyl-protein thioesterase 2 | |
|---|---|
| Refseq ID | NP_036072 |
| Protein GI | 7242156 |
| UniProt ID | Q9WTL7 |
| mRNA ID | NM_011942 |
| Length | 231 |
| RefSeq Status | PROVISIONAL |
| MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRNFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRTVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016787 | IEA:UniProtKB-KW | F | hydrolase activity |
| GO:0006631 | IEA:UniProtKB-KW | P | fatty acid metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-protein + H(2)O = palmitate + protein. |
| Function | May hydrolyze fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Deacylates GAP43 (By similarity). Has lysophospholipase activity. {ECO:0000250, ECO:0000269|PubMed:10064901}. |
| Similarity | Belongs to the AB hydrolase superfamily. AB hydrolase 2 family. {ECO:0000305}. |
| Subcellular Location | Cytoplasm {ECO:0000305}. |
| Tissue Specificity | Ubiquitous; detected at low levels. {ECO:0000269|PubMed:10064901}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000746 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 7242156 | RefSeq | NP_036072 | 231 | acyl-protein thioesterase 2 |
Identical Sequences to LMP000746 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7242156 | DBBJ | BAC40757.1 | 231 | unnamed protein product [Mus musculus] |
| GI:7242156 | DBBJ | BAE39559.1 | 231 | unnamed protein product [Mus musculus] |
| GI:7242156 | GenBank | AAH68120.1 | 231 | Lysophospholipase 2 [Mus musculus] |
| GI:7242156 | GenBank | EDL29957.1 | 231 | lysophospholipase 2, isoform CRA_a [Mus musculus] |
| GI:7242156 | GenBank | EDL29958.1 | 231 | lysophospholipase 2, isoform CRA_a [Mus musculus] |
| GI:7242156 | SwissProt | Q9WTL7.1 | 231 | RecName: Full=Acyl-protein thioesterase 2; Short=APT-2; AltName: Full=Lysophospholipase 2; AltName: Full=Lysophospholipase II; Short=LPL-II; Short=LysoPLA II; Short=mLyso II [Mus musculus] |
Related Sequences to LMP000746 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7242156 | GenBank | EDL80788.1 | 231 | lysophospholipase 2, isoform CRA_a [Rattus norvegicus] |
| GI:7242156 | GenBank | EDL80789.1 | 231 | lysophospholipase 2, isoform CRA_a [Rattus norvegicus] |
| GI:7242156 | RefSeq | XP_005317651.1 | 231 | PREDICTED: acyl-protein thioesterase 2 [Ictidomys tridecemlineatus] |
| GI:7242156 | RefSeq | XP_006538940.1 | 356 | PREDICTED: acyl-protein thioesterase 2 isoform X1 [Mus musculus] |
| GI:7242156 | RefSeq | XP_008846820.1 | 231 | PREDICTED: acyl-protein thioesterase 2 [Nannospalax galili] |
| GI:7242156 | SwissProt | Q9QYL8.1 | 231 | RecName: Full=Acyl-protein thioesterase 2; Short=APT-2; AltName: Full=Lysophospholipase 2; AltName: Full=Lysophospholipase II; Short=LPL-II; Short=LysoPLA II [Rattus norvegicus] |