Gene/Proteome Database (LMPD)
LMPD ID
LMP000775
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
Gene Symbol
Synonyms
SIAT7-D; ST6GalNAcIV; Siat7d
Chromosome
2
Map Location
2 B|2
Proteins
alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase | |
---|---|
Refseq ID | NP_001263354 |
Protein GI | 449083362 |
UniProt ID | Q8C3J2 |
mRNA ID | NM_001276425 |
Length | 302 |
RefSeq Status | VALIDATED |
MKAPGRLLLLTLCILTFSAVCVFLCCWACLPLCLATCLDRHLPAAPRSTVPGPLHFSGYSSVPDGKPLIRELCHSCAVVSSSGQMLGSGLGAQIDGAECVLRMNQAPTVGFEEDVGQRSTLRVISHTSVPLLLRNYSHYFQHARDTLYVVWGQGRHMDRVLGGRTYRTLLQLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMILALELCEEIVVYGMVSDSYCSEKSPRSVPYHYFEKGRLDECQMYRLHEQAPRSAHRFITEKAVFSRWAKKRPIVFAHPSWRAK |
Gene Information
Entrez Gene ID
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008373 | IEA:InterPro | F | sialyltransferase activity |
GO:0006486 | IEA:InterPro | P | protein glycosylation |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001675 | Glycosyl transferase, family 29 |
UniProt Annotations
Entry Information
Gene Name
ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4
Protein Entry
SIA7D_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP000775 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
449083362 | RefSeq | NP_001263354 | 302 | alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase |
Identical Sequences to LMP000775 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:449083362 | DBBJ | BAC39523.1 | 302 | unnamed protein product [Mus musculus] |
GI:449083362 | DBBJ | BAE35308.1 | 302 | unnamed protein product [Mus musculus] |
GI:449083362 | GenBank | AAH86784.1 | 302 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4 [Mus musculus] |
GI:449083362 | GenBank | AAH56451.2 | 302 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4 [Mus musculus] |
GI:449083362 | GenBank | EDL08556.1 | 302 | ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 4 [Mus musculus] |
GI:449083362 | RefSeq | NP_035503.1 | 302 | alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase [Mus musculus] |
Related Sequences to LMP000775 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:449083362 | DBBJ | BAE36463.1 | 376 | unnamed protein product, partial [Mus musculus] |
GI:449083362 | DBBJ | BAE26116.1 | 378 | unnamed protein product, partial [Mus musculus] |
GI:449083362 | DBBJ | BAE31668.1 | 368 | unnamed protein product, partial [Mus musculus] |
GI:449083362 | EMBL | CAB43514.1 | 360 | Sia-alpha-2-3-Gal-beta-1-3-GalNAc GalNAc-alpha-2,6-sialyltransferase [Mus musculus] |
GI:449083362 | EMBL | CAB43515.1 | 302 | Sia-alpha-2-3-Gal-beta-1-3-GalNAc GalNAc-alpha-2,6-sialyltransferase [Mus musculus] |
GI:449083362 | SwissProt | Q9R2B6.1 | 360 | RecName: Full=Alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3-N-acetyl-galactosaminide alpha-2,6-sialyltransferase; AltName: Full=NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc-alpha-2,6-sialyltransferase; AltName: Full=ST6GalNAc IV; Short=ST6GalNAcIV; AltName: Full=Sialyltransferase 7D; Short=SIAT7-D [Mus musculus] |