Gene/Proteome Database (LMPD)
LMPD ID
LMP000875
Gene ID
Species
Mus musculus (Mouse)
Gene Name
cysteinyl leukotriene receptor 1
Gene Symbol
Synonyms
BB147369; CysLT1R; Cyslt1
Alternate Names
cysteinyl leukotriene receptor 1; LTD4 receptor; cysteinyl leukotriene D4 receptor; cysteinyl leukotriene 1 receptor short isoform
Chromosome
X
Map Location
X|X D
Proteins
cysteinyl leukotriene receptor 1 isoform a | |
---|---|
Refseq ID | NP_067451 |
Protein GI | 31542449 |
UniProt ID | Q99JA4 |
mRNA ID | NM_021476 |
Length | 352 |
RefSeq Status | VALIDATED |
MYLQGTKQTFLENMNGTENLTTSLINNTCHDTIDEFRNQVYSTMYSVISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKWLFGDFLCRLTTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIWIFVILTSSPFLMYKSYQDEKNNTKCFEPPQNNQAKKYVLILHYVSLFFGFIIPFVTIIVCYTMIILTLLKNTMKKNMPSRRKAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKASLPEKGEEICNE |
cysteinyl leukotriene receptor 1 isoform a | |
---|---|
Refseq ID | NP_001268788 |
Protein GI | 530230387 |
UniProt ID | Q99JA4 |
mRNA ID | NM_001281859 |
Length | 352 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:31542449 (mRNA isoform) |
cysteinyl leukotriene receptor 1 isoform b | |
---|---|
Refseq ID | NP_001268791 |
Protein GI | 530230714 |
UniProt ID | Q99JA4 |
mRNA ID | NM_001281862 |
Length | 339 |
RefSeq Status | VALIDATED |
MNGTENLTTSLINNTCHDTIDEFRNQVYSTMYSVISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKWLFGDFLCRLTTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCIGIWIFVILTSSPFLMYKSYQDEKNNTKCFEPPQNNQAKKYVLILHYVSLFFGFIIPFVTIIVCYTMIILTLLKNTMKKNMPSRRKAIGMIIVVTAAFLVSFMPYHIQRTIHLHLLHSETRPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYVPKKKASLPEKGEEICNE |
Gene Information
Entrez Gene ID
Gene Name
cysteinyl leukotriene receptor 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005887 | IDA:MGI | C | integral component of plasma membrane |
GO:0004974 | IDA:MGI | F | leukotriene receptor activity |
GO:0006816 | IDA:MGI | P | calcium ion transport |
GO:0007166 | IDA:MGI | P | cell surface receptor signaling pathway |
GO:0006935 | IDA:MGI | P | chemotaxis |
GO:0006954 | IEA:Ensembl | P | inflammatory response |
GO:0045766 | IEA:Ensembl | P | positive regulation of angiogenesis |
GO:0045907 | IEA:Ensembl | P | positive regulation of vasoconstriction |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu04020 | Calcium signaling pathway |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cysteinyl leukotriene receptor 1
Protein Entry
CLTR1_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=Long; IsoId=Q99JA4-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=Q99JA4-2; Sequence=VSP_001921; |
Function | Receptor for cysteinyl leukotrienes mediating constriction of the microvascular smooth muscle during an inflammatory response. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The rank order of affinities for the leukotrienes is LTD4 >> LTE4 = LTC4 >> LTB4. |
Miscellaneous | MK-571, a selective antagonist, was shown to inhibit eosinophilia, bronchial hyperreactivity and microvascular leakage. Zafirlukast (Accolate) and pranlukast (Onon) were also shown to be selective antagonists. |
Similarity | Belongs to the G-protein coupled receptor 1 family. {ECO:0000255|PROSITE-ProRule:PRU00521}. |
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Tissue Specificity | Widely expressed, with higher expression in the lung and skin, intermediate levels in the heart, kidney and stomach and lower levels in several other tissues. Isoform 1 is the most abundant form in all tested tissues. |
Identical and Related Proteins
Unique RefSeq proteins for LMP000875 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
31542449 | RefSeq | NP_067451 | 352 | cysteinyl leukotriene receptor 1 isoform a |
530230714 | RefSeq | NP_001268791 | 339 | cysteinyl leukotriene receptor 1 isoform b |
Identical Sequences to LMP000875 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:530230714 | DBBJ | BAA96809.1 | 339 | CysLT1 [Mus musculus] |
GI:31542449 | DBBJ | BAC28308.1 | 352 | unnamed protein product [Mus musculus] |
GI:530230714 | GenBank | AAK16716.1 | 339 | cysteinyl leukotriene 1 receptor short isoform [Mus musculus] |
GI:31542449 | GenBank | AAH27102.1 | 352 | Cysteinyl leukotriene receptor 1 [Mus musculus] |
GI:31542449 | GenBank | EDL14049.1 | 352 | cysteinyl leukotriene receptor 1, isoform CRA_a [Mus musculus] |
GI:31542449 | GenBank | EDL14050.1 | 352 | cysteinyl leukotriene receptor 1, isoform CRA_a [Mus musculus] |
GI:31542449 | RefSeq | NP_001268788.1 | 352 | cysteinyl leukotriene receptor 1 isoform a [Mus musculus] |
GI:530230714 | RefSeq | XP_006528275.1 | 339 | PREDICTED: cysteinyl leukotriene receptor 1 isoform X1 [Mus musculus] |
GI:31542449 | SwissProt | Q99JA4.1 | 352 | RecName: Full=Cysteinyl leukotriene receptor 1; Short=CysLTR1; AltName: Full=Cysteinyl leukotriene D4 receptor; Short=LTD4 receptor [Mus musculus] |
Related Sequences to LMP000875 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31542449 | DBBJ | BAA96809.1 | 339 | CysLT1 [Mus musculus] |
GI:530230714 | DBBJ | BAC28308.1 | 352 | unnamed protein product [Mus musculus] |
GI:31542449 | GenBank | AAF73047.1 | 352 | leukotriene D4 receptor [Mus musculus] |
GI:530230714 | GenBank | AAK16715.1 | 352 | cysteinyl leukotriene 1 receptor long isoform [Mus musculus] |
GI:31542449 | GenBank | AAK16716.1 | 339 | cysteinyl leukotriene 1 receptor short isoform [Mus musculus] |
GI:530230714 | GenBank | EDL14049.1 | 352 | cysteinyl leukotriene receptor 1, isoform CRA_a [Mus musculus] |
GI:530230714 | GenBank | EDL14050.1 | 352 | cysteinyl leukotriene receptor 1, isoform CRA_a [Mus musculus] |
GI:31542449 | GenBank | EDM07131.1 | 352 | rCG37983, isoform CRA_a [Rattus norvegicus] |
GI:530230714 | RefSeq | NP_067451.2 | 352 | cysteinyl leukotriene receptor 1 isoform a [Mus musculus] |
GI:530230714 | RefSeq | NP_001268788.1 | 352 | cysteinyl leukotriene receptor 1 isoform a [Mus musculus] |
GI:31542449 | RefSeq | NP_001268791.1 | 339 | cysteinyl leukotriene receptor 1 isoform b [Mus musculus] |
GI:31542449 | RefSeq | XP_006528275.1 | 339 | PREDICTED: cysteinyl leukotriene receptor 1 isoform X1 [Mus musculus] |