Gene/Proteome Database (LMPD)

LMPD ID
LMP000879
Gene ID
94224
Species
Mus musculus (Mouse)
Gene Name
steroid 5 alpha-reductase 2
Gene Symbol
Srd5a2
Synonyms
5ART2; S5AR 2
Alternate Names
3-oxo-5-alpha-steroid 4-dehydrogenase 2; SR type 2; 5 alpha-SR2; steroid 5-alpha-reductase 2; steroid 5 alpha reductase type2
Chromosome
17
Map Location
17 E2|17
EC Number
1.3.1.22

Proteins

3-oxo-5-alpha-steroid 4-dehydrogenase 2
Refseq ID NP_444418
Protein GI 16716485
UniProt ID Q99N99
mRNA ID NM_053188
Length 254
RefSeq Status PROVISIONAL
MPIVCHQVPVLAGSATLATMGTLILCFGKPASYGKHSESVSSGVPLLPARIAWFLQELPSFVVSVGMLAWQPRSLFGPPGNVLLGLFSAHYFHRTFIYSLLTRGRPLSAVIFLKATAFCIGNGLLQAYYLVYCAEYPEEWYTDMRFSVGVFFFILGMGINIHSDCMLRQLRKPGEVIYRIPQGGLFTYVSGANFLGEIIEWMGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFKDYPKSRKALIPFIF

Gene Information

Entrez Gene ID
94224
Gene Name
steroid 5 alpha-reductase 2
Gene Symbol
Srd5a2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070852 IEA:Ensembl C cell body fiber
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0043025 IEA:Ensembl C neuronal cell body
GO:0003865 IMP:MGI F 3-oxo-5-alpha-steroid 4-dehydrogenase activity
GO:0033218 IEA:Ensembl F amide binding
GO:0047751 IEA:UniProtKB-EC F cholestenone 5-alpha-reductase activity
GO:0006702 IMP:MGI P androgen biosynthetic process
GO:0018879 IEA:Ensembl P biphenyl metabolic process
GO:0060348 IEA:Ensembl P bone development
GO:0030154 IEA:UniProtKB-KW P cell differentiation
GO:0018894 IEA:Ensembl P dibenzo-p-dioxin metabolic process
GO:0030540 IEA:Ensembl P female genitalia development
GO:0021766 IEA:Ensembl P hippocampus development
GO:0021854 IEA:Ensembl P hypothalamus development
GO:0030539 IMP:MGI P male genitalia development
GO:0008584 IEA:Ensembl P male gonad development
GO:0018963 IEA:Ensembl P phthalate metabolic process
GO:0042493 IEA:Ensembl P response to drug
GO:0032354 IEA:Ensembl P response to follicle-stimulating hormone
GO:0031667 IEA:Ensembl P response to nutrient levels
GO:0043434 IEA:Ensembl P response to peptide hormone
GO:0033574 IEA:Ensembl P response to testosterone
GO:0006694 IMP:MGI P steroid biosynthetic process
GO:0006706 IEA:Ensembl P steroid catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
ko05215 Prostate cancer
mmu05215 Prostate cancer
ko00140 Steroid hormone biosynthesis
mmu00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR016636 3-oxo-5-alpha-steroid 4-dehydrogenase
IPR001104 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal

UniProt Annotations

Entry Information

Gene Name
steroid 5 alpha-reductase 2
Protein Entry
S5A2_MOUSE
UniProt ID
Q99N99
Species
Mouse

Comments

Comment Type Description
Catalytic Activity A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH.
Function Converts testosterone (T) into 5-alpha- dihydrotestosterone (DHT) and progesterone or corticosterone into their corresponding 5-alpha-3-oxosteroids. It plays a central role in sexual differentiation and androgen physiology (By similarity). {ECO:0000250}.
Similarity Belongs to the steroid 5-alpha reductase family. {ECO:0000305}.
Subcellular Location Microsome membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP000879 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16716485 RefSeq NP_444418 254 3-oxo-5-alpha-steroid 4-dehydrogenase 2

Identical Sequences to LMP000879 proteins

Reference Database Accession Length Protein Name
GI:16716485 DBBJ BAB40179.1 254 steroid 5 alpha reductase type 2 [Mus musculus]
GI:16716485 DBBJ BAE23830.1 254 unnamed protein product [Mus musculus]
GI:16716485 GenBank AAI25511.1 254 Steroid 5 alpha-reductase 2 [Mus musculus]
GI:16716485 GenBank EDL38421.1 254 steroid 5 alpha-reductase 2, isoform CRA_b [Mus musculus]
GI:16716485 SwissProt Q99N99.1 254 RecName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 2; AltName: Full=5 alpha-SR2; AltName: Full=SR type 2; AltName: Full=Steroid 5-alpha-reductase 2; Short=S5AR 2 [Mus musculus]

Related Sequences to LMP000879 proteins

Reference Database Accession Length Protein Name
GI:16716485 GenBank AAA42182.1 254 steroid 5-alpha-reductase 2 [Rattus norvegicus]
GI:16716485 GenBank AAE95372.1 238 Sequence 6 from patent US 6352846
GI:16716485 GenBank EDM02850.1 254 steroid 5-alpha-reductase 2 [Rattus norvegicus]
GI:16716485 RefSeq NP_073202.1 254 3-oxo-5-alpha-steroid 4-dehydrogenase 2 [Rattus norvegicus]
GI:16716485 RefSeq XP_007633046.1 254 PREDICTED: 3-oxo-5-alpha-steroid 4-dehydrogenase 2 isoform X4 [Cricetulus griseus]
GI:16716485 SwissProt P31214.1 254 RecName: Full=3-oxo-5-alpha-steroid 4-dehydrogenase 2; AltName: Full=5 alpha-SR2; AltName: Full=SR type 2; AltName: Full=Steroid 5-alpha-reductase 2; Short=S5AR 2 [Rattus norvegicus]