Gene/Proteome Database (LMPD)

LMPD ID
LMP000944
Gene ID
5571
Species
Homo sapiens (Human)
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Symbol
PRKAG1
Synonyms
AMPKG
Alternate Names
5'-AMP-activated protein kinase subunit gamma-1;,AMPK gamma1; AMPK gamma-1 chain', "5'-AMP-activated protein kinase, gamma-1 subunit
Chromosome
12
Map Location
12q12-q14
Summary
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for PRKAG1

Proteins

5'-AMP-activated protein kinase subunit gamma-1 isoform 1
Refseq ID NP_002724
Protein GI 4506061
UniProt ID P54619
mRNA ID NM_002733
Length 331
RefSeq Status REVIEWED
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
5'-AMP-activated protein kinase subunit gamma-1 isoform 3
Refseq ID NP_001193638
Protein GI 332000015
UniProt ID P54619
mRNA ID NM_001206709
Length 340
RefSeq Status REVIEWED
METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVVLRALSCPLGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
5'-AMP-activated protein kinase subunit gamma-1 isoform 4
Refseq ID NP_001193639
Protein GI 332000017
UniProt ID P54619
mRNA ID NM_001206710
Length 299
RefSeq Status REVIEWED
MKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP

Gene Information

Entrez Gene ID
5571
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Symbol
PRKAG1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031588 ISS:UniProtKB C AMP-activated protein kinase complex
GO:0005829 TAS:Reactome C cytosol
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0016020 IDA:UniProtKB C membrane
GO:0005634 IEA:Ensembl C nucleus
GO:0043531 ISS:UniProtKB F ADP binding
GO:0016208 ISS:UniProtKB F AMP binding
GO:0005524 ISS:UniProtKB F ATP binding
GO:0004691 TAS:ProtInc F cAMP-dependent protein kinase activity
GO:0008603 TAS:BHF-UCL F cAMP-dependent protein kinase regulator activity
GO:0004672 IDA:UniProtKB F protein kinase activity
GO:0019901 IDA:BHF-UCL F protein kinase binding
GO:0007050 TAS:Reactome P cell cycle arrest
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process
GO:0008286 TAS:Reactome P insulin receptor signaling pathway
GO:0061024 TAS:Reactome P membrane organization
GO:0010628 IDA:UniProtKB P positive regulation of gene expression
GO:0045860 TAS:BHF-UCL P positive regulation of protein kinase activity
GO:0051291 IEA:Ensembl P protein heterooligomerization
GO:0006468 IDA:UniProtKB P protein phosphorylation
GO:0006110 TAS:BHF-UCL P regulation of glycolytic process
GO:0007165 TAS:ProtInc P signal transduction
GO:0007283 TAS:ProtInc P spermatogenesis

KEGG Pathway Links

KEGG Pathway ID Description
hsa04152 AMPK signaling pathway
hsa04068 FoxO signaling pathway
hsa04932 Non-alcoholic fatty liver disease (NAFLD)
hsa04921 Oxytocin signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR000644 CBS domain

UniProt Annotations

Entry Information

Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Protein Entry
AAKG1_HUMAN
UniProt ID
P54619
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P54619-1; Sequence=Displayed; Name=2; IsoId=P54619-2; Sequence=VSP_046711; Note=No experimental confirmation available.; Name=3; IsoId=P54619-3; Sequence=VSP_046712; Note=No experimental confirmation available. May be due to competing acceptor splice site.;
Domain The AMPK pseudosubstrate motif resembles the sequence around sites phosphorylated on target proteins of AMPK, except the presence of a non-phosphorylatable residue in place of Ser. In the absence of AMP this pseudosubstrate sequence may bind to the active site groove on the alpha subunit (PRKAA1 or PRKAA2), preventing phosphorylation by the upstream activating kinase STK11/LKB1.
Domain The CBS domains mediate binding to AMP, ADP and ATP. 2 sites bind either AMP or ATP, whereas a third site contains a tightly bound AMP that does not exchange. Under physiological conditions AMPK mainly exists in its inactive form in complex with ATP, which is much more abundant than AMP.
Function AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK
Interaction Q9Y478:PRKAB1; NbExp=4; IntAct=EBI-1181439, EBI-719769; O43741:PRKAB2; NbExp=3; IntAct=EBI-1181439, EBI-1053424;
Ptm Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK.
Similarity Belongs to the 5'-AMP-activated protein kinase gamma subunit family.
Similarity Contains 4 CBS domains. {ECO
Subunit AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). Interacts with FNIP1 and FNIP2. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP000944 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4506061 RefSeq NP_002724 331 5'-AMP-activated protein kinase subunit gamma-1 isoform 1
332000015 RefSeq NP_001193638 340 5'-AMP-activated protein kinase subunit gamma-1 isoform 3
332000017 RefSeq NP_001193639 299 5'-AMP-activated protein kinase subunit gamma-1 isoform 4

Identical Sequences to LMP000944 proteins

Reference Database Accession Length Protein Name
GI:332000015 DBBJ BAC05117.1 340 unnamed protein product [Homo sapiens]
GI:332000017 DBBJ BAG56848.1 299 unnamed protein product [Homo sapiens]
GI:4506061 GenBank AIC49472.1 331 PRKAG1, partial [synthetic construct]
GI:4506061 GenBank AIC62571.1 331 PRKAG1, partial [synthetic construct]
GI:4506061 PDB 4CFE 331 Chain E, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Benzimidazole Derivative (991)
GI:4506061 PDB 4CFE 331 Chain F, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Benzimidazole Derivative (991)
GI:4506061 PDB 4CFF 331 Chain E, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Thienopyridone Derivative (a-769662)
GI:4506061 PDB 4CFF 331 Chain F, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Thienopyridone Derivative (a-769662)
GI:332000017 RefSeq XP_004053113.1 299 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform 2 [Gorilla gorilla gorilla]
GI:332000017 RefSeq XP_005570797.1 299 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X2 [Macaca fascicularis]
GI:332000017 RefSeq NP_001270454.1 299 uncharacterized LOC101865279 [Macaca fascicularis]
GI:332000017 RefSeq XP_006719562.1 299 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X3 [Homo sapiens]
GI:332000017 RefSeq XP_008568892.1 299 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 [Galeopterus variegatus]

Related Sequences to LMP000944 proteins

Reference Database Accession Length Protein Name
GI:332000017 GenBank AAC50495.1 331 5'-AMP-activated protein kinase, gamma-1 subunit [Homo sapiens]
GI:332000017 GenBank AAV20951.1 331 Sequence 1211 from patent US 6753314
GI:332000015 GenBank EAW58032.1 331 protein kinase, AMP-activated, gamma 1 non-catalytic subunit, isoform CRA_a [Homo sapiens]
GI:332000017 GenBank EAW58032.1 331 protein kinase, AMP-activated, gamma 1 non-catalytic subunit, isoform CRA_a [Homo sapiens]
GI:332000017 GenBank EAW58033.1 331 protein kinase, AMP-activated, gamma 1 non-catalytic subunit, isoform CRA_a [Homo sapiens]
GI:4506061 GenBank ACM85383.1 336 Sequence 10881 from patent US 6812339
GI:332000015 GenBank EHH20691.1 337 5'-AMP-activated protein kinase subunit gamma-1, partial [Macaca mulatta]
GI:332000015 GenBank EHH66244.1 337 5'-AMP-activated protein kinase subunit gamma-1, partial [Macaca fascicularis]
GI:332000017 GenBank AIC49472.1 331 PRKAG1, partial [synthetic construct]
GI:4506061 RefSeq XP_002823223.1 331 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 [Pongo abelii]
GI:4506061 RefSeq XP_004053112.1 331 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform 1 [Gorilla gorilla gorilla]
GI:332000015 RefSeq XP_004053114.1 340 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform 3 [Gorilla gorilla gorilla]
GI:332000015 RefSeq XP_004088686.1 340 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 [Nomascus leucogenys]
GI:332000015 RefSeq XP_004692845.1 344 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X1 [Condylura cristata]
GI:4506061 RefSeq XP_005570796.1 331 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X1 [Macaca fascicularis]
GI:4506061 RefSeq XP_008001300.1 331 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X1 [Chlorocebus sabaeus]
GI:4506061 RefSeq XP_010383720.1 331 PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X1 [Rhinopithecus roxellana]
GI:332000017 SwissProt P54619.1 331 RecName: Full=5'-AMP-activated protein kinase subunit gamma-1; Short=AMPK gamma1; Short=AMPK subunit gamma-1; Short=AMPKg [Homo sapiens]