Gene/Proteome Database (LMPD)
LMPD ID
LMP000944
Gene ID
Species
Homo sapiens (Human)
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Symbol
Synonyms
AMPKG
Alternate Names
5'-AMP-activated protein kinase subunit gamma-1;,AMPK gamma1; AMPK gamma-1 chain', "5'-AMP-activated protein kinase, gamma-1 subunit
Chromosome
12
Map Location
12q12-q14
Summary
The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| 5'-AMP-activated protein kinase subunit gamma-1 isoform 1 | |
|---|---|
| Refseq ID | NP_002724 |
| Protein GI | 4506061 |
| UniProt ID | P54619 |
| mRNA ID | NM_002733 |
| Length | 331 |
| RefSeq Status | REVIEWED |
| METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP | |
| 5'-AMP-activated protein kinase subunit gamma-1 isoform 3 | |
|---|---|
| Refseq ID | NP_001193638 |
| Protein GI | 332000015 |
| UniProt ID | P54619 |
| mRNA ID | NM_001206709 |
| Length | 340 |
| RefSeq Status | REVIEWED |
| METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVVLRALSCPLGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP | |
| 5'-AMP-activated protein kinase subunit gamma-1 isoform 4 | |
|---|---|
| Refseq ID | NP_001193639 |
| Protein GI | 332000017 |
| UniProt ID | P54619 |
| mRNA ID | NM_001206710 |
| Length | 299 |
| RefSeq Status | REVIEWED |
| MKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP | |
Gene Information
Entrez Gene ID
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031588 | ISS:UniProtKB | C | AMP-activated protein kinase complex |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0005634 | IEA:Ensembl | C | nucleus |
| GO:0043531 | ISS:UniProtKB | F | ADP binding |
| GO:0016208 | ISS:UniProtKB | F | AMP binding |
| GO:0005524 | ISS:UniProtKB | F | ATP binding |
| GO:0004691 | TAS:ProtInc | F | cAMP-dependent protein kinase activity |
| GO:0008603 | TAS:BHF-UCL | F | cAMP-dependent protein kinase regulator activity |
| GO:0004672 | IDA:UniProtKB | F | protein kinase activity |
| GO:0019901 | IDA:BHF-UCL | F | protein kinase binding |
| GO:0007050 | TAS:Reactome | P | cell cycle arrest |
| GO:0006633 | IEA:UniProtKB-KW | P | fatty acid biosynthetic process |
| GO:0008286 | TAS:Reactome | P | insulin receptor signaling pathway |
| GO:0061024 | TAS:Reactome | P | membrane organization |
| GO:0010628 | IDA:UniProtKB | P | positive regulation of gene expression |
| GO:0045860 | TAS:BHF-UCL | P | positive regulation of protein kinase activity |
| GO:0051291 | IEA:Ensembl | P | protein heterooligomerization |
| GO:0006468 | IDA:UniProtKB | P | protein phosphorylation |
| GO:0006110 | TAS:BHF-UCL | P | regulation of glycolytic process |
| GO:0007165 | TAS:ProtInc | P | signal transduction |
| GO:0007283 | TAS:ProtInc | P | spermatogenesis |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000644 | CBS domain |
UniProt Annotations
Entry Information
Gene Name
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Protein Entry
AAKG1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P54619-1; Sequence=Displayed; Name=2; IsoId=P54619-2; Sequence=VSP_046711; Note=No experimental confirmation available.; Name=3; IsoId=P54619-3; Sequence=VSP_046712; Note=No experimental confirmation available. May be due to competing acceptor splice site.; |
| Domain | The AMPK pseudosubstrate motif resembles the sequence around sites phosphorylated on target proteins of AMPK, except the presence of a non-phosphorylatable residue in place of Ser. In the absence of AMP this pseudosubstrate sequence may bind to the active site groove on the alpha subunit (PRKAA1 or PRKAA2), preventing phosphorylation by the upstream activating kinase STK11/LKB1. |
| Domain | The CBS domains mediate binding to AMP, ADP and ATP. 2 sites bind either AMP or ATP, whereas a third site contains a tightly bound AMP that does not exchange. Under physiological conditions AMPK mainly exists in its inactive form in complex with ATP, which is much more abundant than AMP. |
| Function | AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK |
| Interaction | Q9Y478:PRKAB1; NbExp=4; IntAct=EBI-1181439, EBI-719769; O43741:PRKAB2; NbExp=3; IntAct=EBI-1181439, EBI-1053424; |
| Ptm | Phosphorylated by ULK1 and ULK2; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1, ULK2 and AMPK. |
| Similarity | Belongs to the 5'-AMP-activated protein kinase gamma subunit family. |
| Similarity | Contains 4 CBS domains. {ECO |
| Subunit | AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). Interacts with FNIP1 and FNIP2. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP000944 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4506061 | RefSeq | NP_002724 | 331 | 5'-AMP-activated protein kinase subunit gamma-1 isoform 1 |
| 332000015 | RefSeq | NP_001193638 | 340 | 5'-AMP-activated protein kinase subunit gamma-1 isoform 3 |
| 332000017 | RefSeq | NP_001193639 | 299 | 5'-AMP-activated protein kinase subunit gamma-1 isoform 4 |
Identical Sequences to LMP000944 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:332000015 | DBBJ | BAC05117.1 | 340 | unnamed protein product [Homo sapiens] |
| GI:332000017 | DBBJ | BAG56848.1 | 299 | unnamed protein product [Homo sapiens] |
| GI:4506061 | GenBank | AIC49472.1 | 331 | PRKAG1, partial [synthetic construct] |
| GI:4506061 | GenBank | AIC62571.1 | 331 | PRKAG1, partial [synthetic construct] |
| GI:4506061 | PDB | 4CFE | 331 | Chain E, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Benzimidazole Derivative (991) |
| GI:4506061 | PDB | 4CFE | 331 | Chain F, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Benzimidazole Derivative (991) |
| GI:4506061 | PDB | 4CFF | 331 | Chain E, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Thienopyridone Derivative (a-769662) |
| GI:4506061 | PDB | 4CFF | 331 | Chain F, Structure Of Full Length Human Ampk In Complex With A Small Molecule Activator, A Thienopyridone Derivative (a-769662) |
| GI:332000017 | RefSeq | XP_004053113.1 | 299 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform 2 [Gorilla gorilla gorilla] |
| GI:332000017 | RefSeq | XP_005570797.1 | 299 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X2 [Macaca fascicularis] |
| GI:332000017 | RefSeq | NP_001270454.1 | 299 | uncharacterized LOC101865279 [Macaca fascicularis] |
| GI:332000017 | RefSeq | XP_006719562.1 | 299 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X3 [Homo sapiens] |
| GI:332000017 | RefSeq | XP_008568892.1 | 299 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 [Galeopterus variegatus] |
Related Sequences to LMP000944 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:332000017 | GenBank | AAC50495.1 | 331 | 5'-AMP-activated protein kinase, gamma-1 subunit [Homo sapiens] |
| GI:332000017 | GenBank | AAV20951.1 | 331 | Sequence 1211 from patent US 6753314 |
| GI:332000015 | GenBank | EAW58032.1 | 331 | protein kinase, AMP-activated, gamma 1 non-catalytic subunit, isoform CRA_a [Homo sapiens] |
| GI:332000017 | GenBank | EAW58032.1 | 331 | protein kinase, AMP-activated, gamma 1 non-catalytic subunit, isoform CRA_a [Homo sapiens] |
| GI:332000017 | GenBank | EAW58033.1 | 331 | protein kinase, AMP-activated, gamma 1 non-catalytic subunit, isoform CRA_a [Homo sapiens] |
| GI:4506061 | GenBank | ACM85383.1 | 336 | Sequence 10881 from patent US 6812339 |
| GI:332000015 | GenBank | EHH20691.1 | 337 | 5'-AMP-activated protein kinase subunit gamma-1, partial [Macaca mulatta] |
| GI:332000015 | GenBank | EHH66244.1 | 337 | 5'-AMP-activated protein kinase subunit gamma-1, partial [Macaca fascicularis] |
| GI:332000017 | GenBank | AIC49472.1 | 331 | PRKAG1, partial [synthetic construct] |
| GI:4506061 | RefSeq | XP_002823223.1 | 331 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 [Pongo abelii] |
| GI:4506061 | RefSeq | XP_004053112.1 | 331 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform 1 [Gorilla gorilla gorilla] |
| GI:332000015 | RefSeq | XP_004053114.1 | 340 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform 3 [Gorilla gorilla gorilla] |
| GI:332000015 | RefSeq | XP_004088686.1 | 340 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 [Nomascus leucogenys] |
| GI:332000015 | RefSeq | XP_004692845.1 | 344 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X1 [Condylura cristata] |
| GI:4506061 | RefSeq | XP_005570796.1 | 331 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X1 [Macaca fascicularis] |
| GI:4506061 | RefSeq | XP_008001300.1 | 331 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X1 [Chlorocebus sabaeus] |
| GI:4506061 | RefSeq | XP_010383720.1 | 331 | PREDICTED: 5'-AMP-activated protein kinase subunit gamma-1 isoform X1 [Rhinopithecus roxellana] |
| GI:332000017 | SwissProt | P54619.1 | 331 | RecName: Full=5'-AMP-activated protein kinase subunit gamma-1; Short=AMPK gamma1; Short=AMPK subunit gamma-1; Short=AMPKg [Homo sapiens] |