Gene/Proteome Database (LMPD)
Proteins
| putative inactive group IIC secretory phospholipase A2 precursor | |
|---|---|
| Refseq ID | NP_001099042 |
| Protein GI | 157743243 |
| UniProt ID | J3KMZ3 |
| mRNA ID | NM_001105572 |
| Length | 150 |
| RefSeq Status | PROVISIONAL |
| MLIATSFFLFFSSVVAAPTHSSFWQFQRRVKHITGRSAFFSYYGYGCYCGLGDKGIPVDDTDSPSSPSPYEKLKEFSCQPVLNSYQFHIVNGAVVCGCTLGPGASCHCRLKACECDKQSVHCFKESLPTYEKNFKQFSSQPRCGRHKPWC | |
| sig_peptide: 1..16 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1780 peptide sequence: MLIATSFFLFFSSVVA | |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group IIC
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0047498 | IEA:Ensembl | F | calcium-dependent phospholipase A2 activity |
| GO:0016042 | IEA:InterPro | P | lipid catabolic process |
| GO:0006644 | IEA:InterPro | P | phospholipid metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. |
| Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
| Cofactor | Note=Binds 1 calcium ion per subunit. ; |
| Similarity | Belongs to the phospholipase A2 family. |
| Subcellular Location | Secreted . |
Identical and Related Proteins
Unique RefSeq proteins for LMP000961 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157743243 | RefSeq | NP_001099042 | 150 | putative inactive group IIC secretory phospholipase A2 precursor |
Identical Sequences to LMP000961 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157743243 | GenBank | AEU43346.1 | 150 | Sequence 95 from patent US 8052970 |
Related Sequences to LMP000961 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157743243 | GenBank | EHH14405.1 | 150 | hypothetical protein EGK_00326, partial [Macaca mulatta] |
| GI:157743243 | GenBank | EHH49607.1 | 150 | hypothetical protein EGM_00297, partial [Macaca fascicularis] |
| GI:157743243 | RefSeq | XP_004092316.1 | 211 | PREDICTED: LOW QUALITY PROTEIN: putative inactive group IIC secretory phospholipase A2 [Nomascus leucogenys] |
| GI:157743243 | RefSeq | XP_002811432.3 | 277 | PREDICTED: putative inactive group IIC secretory phospholipase A2 [Pongo abelii] |
| GI:157743243 | RefSeq | XP_010365045.1 | 286 | PREDICTED: putative inactive group IIC secretory phospholipase A2 [Rhinopithecus roxellana] |
| GI:157743243 | SwissProt | Q5R387.3 | 149 | RecName: Full=Putative inactive group IIC secretory phospholipase A2; AltName: Full=Phosphatidylcholine 2-acylhydrolase-like protein GIIC; Flags: Precursor [Homo sapiens] |