Gene/Proteome Database (LMPD)
LMPD ID
LMP000999
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Gene Symbol
Synonyms
AI429591; AW822065; ST3GalII; Siat5
Alternate Names
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2; SIAT4-B; ST3Gal II; ST3GalA.2; gal-NAc6S; alpha 2,3-ST 2; sialyltransferase 5; sialyltransferase 4B; beta-galactoside alpha-2,3-sialyltransferase 2; gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
Chromosome
8
Map Location
8 E1|8
EC Number
2.4.99.4
Proteins
| CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 | |
|---|---|
| Refseq ID | NP_033205 |
| Protein GI | 159110598 |
| UniProt ID | Q11204 |
| mRNA ID | NM_009179 |
| Length | 350 |
| RefSeq Status | VALIDATED |
| MKCSLRVWFLSMAFLLVFIMSLLFTYSHHSMATLPYLDSGALGGTHRVKLVPGYSGLQRLGKEGLLGRNCACSRCMGDASTSEWFDSHFDGNISPVWTRDNMNLPPDVQRWWMMLQPQFKSHNTNEVLEKLFQIVPGENPYRFRDPQQCRRCAVVGNSGNLRGSGYGQEVDSHNFIMRMNQAPTVGFEKDVGSRTTHHFMYPESAKNLPANVSFVLVPFKALDLMWIASALSTGQIRFTYAPVKSFLRVDKEKVQIYNPAFFKYIHDRWTEHHGRYPSTGMLVLFFALHVCDEVNVYGFGADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0003836 | IDA:MGI | F | beta-galactoside (CMP) alpha-2,3-sialyltransferase activity |
| GO:0006486 | IDA:MGI | P | protein glycosylation |
| GO:0097503 | IDA:GOC | P | sialylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu00533 | Glycosaminoglycan biosynthesis - keratan sulfate |
| mmu00603 | Glycosphingolipid biosynthesis - globo series |
| mmu00512 | Mucin type O-Glycan biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5893854 | Keratan sulfate biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 2
Protein Entry
SIA4B_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | CMP-N-acetylneuraminate + beta-D-galactosyl- 1,3-N-acetyl-alpha-D-galactosaminyl-R = CMP + alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1,3-N-acetyl-alpha-D- galactosaminyl-R. |
| Function | It may be responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found in terminal carbohydrate groups of certain glycoproteins, oligosaccharides and glycolipids. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values. |
| Pathway | Protein modification; protein glycosylation. |
| Ptm | The soluble form derives from the membrane form by proteolytic processing. |
| Similarity | Belongs to the glycosyltransferase 29 family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid. |
| Tissue Specificity | Strongly expressed in brain and liver and to a lesser extent in heart and kidney. Scarcely detectable in lung, pancreas, spleen and submaxillary gland. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=ST3Gal II; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_643"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP000999 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 159110598 | RefSeq | NP_033205 | 350 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 |
Identical Sequences to LMP000999 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:159110598 | DBBJ | BAE20742.1 | 350 | unnamed protein product [Mus musculus] |
| GI:159110598 | GenBank | EDL11478.1 | 350 | ST3 beta-galactoside alpha-2,3-sialyltransferase 2, isoform CRA_b [Mus musculus] |
| GI:159110598 | RefSeq | XP_006530849.1 | 350 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X1 [Mus musculus] |
| GI:159110598 | RefSeq | XP_006530850.1 | 350 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X2 [Mus musculus] |
| GI:159110598 | RefSeq | XP_006530851.1 | 350 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X3 [Mus musculus] |
| GI:159110598 | SwissProt | Q11204.2 | 350 | RecName: Full=CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2; Short=Alpha 2,3-ST 2; Short=Beta-galactoside alpha-2,3-sialyltransferase 2; AltName: Full=Gal-NAc6S; AltName: Full=Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase; AltName: Full=ST3Gal II; Short=ST3GalII; AltName: Full=ST3GalA.2; AltName: Full=Sialyltransferase 4B; Short=SIAT4-B [Mus musculus] |
Related Sequences to LMP000999 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:159110598 | DBBJ | BAC28859.1 | 349 | unnamed protein product [Mus musculus] |
| GI:159110598 | EMBL | CAA54294.1 | 350 | Gal beta 1,3-GalNAc alpha-2,3-sialyltransferase [Mus musculus] |
| GI:159110598 | GenBank | AAH15264.1 | 350 | ST3 beta-galactoside alpha-2,3-sialyltransferase 2 [Mus musculus] |
| GI:159110598 | GenBank | AED45519.1 | 379 | Sequence 1377 from patent US 7892730 |
| GI:159110598 | RefSeq | XP_005345725.1 | 350 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Microtus ochrogaster] |
| GI:159110598 | RefSeq | XP_007634480.1 | 350 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 isoform X3 [Cricetulus griseus] |