Gene/Proteome Database (LMPD)

LMPD ID
LMP001000
Gene ID
6484
Species
Homo sapiens (Human)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
ST3GAL4
Synonyms
CGS23; NANTA3; SAT3; SIAT4; SIAT4C; ST3GalIV; STZ
Alternate Names
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; ST-4; SAT-3; SIAT4-C; ST3GalA.2; gal-NAc6S; alpha 2,3-ST 4; alpha 2,3-sialyltransferase IV; alpha-3-N-acetylneuraminyltransferase; beta-galactoside alpha-2,3-sialyltransferase 4; gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase); sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase)
Chromosome
11
Map Location
11q24.2
EC Number
2.4.99.-
Summary
This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be involved in the increased expression of sialyl Lewis X antigen seen in inflammatory responses. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Orthologs
View orthologs and multiple alignments for ST3GAL4

Proteins

CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 1 precursor
Refseq ID NP_006269
Protein GI 5454058
UniProt ID Q11206
mRNA ID NM_006278
Length 329
RefSeq Status VALIDATED
MVSKSRWKLLAMLALVLVVMVWYSISREDSFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2796 peptide sequence: MCPAGWKLLAMLALVLVVMVWYSIS sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3025 peptide sequence: MVSKSRWKLLAMLALVLVVMVWYSIS
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2
Refseq ID NP_001241686
Protein GI 363543346
UniProt ID Q11206
mRNA ID NM_001254757
Length 333
RefSeq Status VALIDATED
MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2
Refseq ID NP_001241687
Protein GI 363543348
UniProt ID Q11206
mRNA ID NM_001254758
Length 333
RefSeq Status VALIDATED
Protein sequence is identical to GI:363543346 (mRNA isoform)
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 3 precursor
Refseq ID NP_001241688
Protein GI 363543350
UniProt ID Q11206
mRNA ID NM_001254759
Length 332
RefSeq Status VALIDATED
MCPAGWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF

Gene Information

Entrez Gene ID
6484
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
ST3GAL4
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 TAS:Reactome C Golgi membrane
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0016020 IDA:UniProtKB C membrane
GO:0003836 TAS:ProtInc F beta-galactoside (CMP) alpha-2,3-sialyltransferase activity
GO:0047288 IEA:Ensembl F monosialoganglioside sialyltransferase activity
GO:0016266 TAS:Reactome P O-glycan processing
GO:0005975 TAS:Reactome P carbohydrate metabolic process
GO:0044267 TAS:Reactome P cellular protein metabolic process
GO:0050890 IMP:UniProt P cognition
GO:0030203 TAS:Reactome P glycosaminoglycan metabolic process
GO:0018146 TAS:Reactome P keratan sulfate biosynthetic process
GO:0042339 TAS:Reactome P keratan sulfate metabolic process
GO:0043687 TAS:Reactome P post-translational protein modification
GO:0018279 TAS:Reactome P protein N-linked glycosylation via asparagine
GO:0097503 TAS:GOC P sialylation
GO:0044281 TAS:Reactome P small molecule metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_121120 Keratan sulfate biosynthesis
REACT_118798 Pre-NOTCH Processing in Golgi
REACT_200874 Sialic acid metabolism
REACT_115835 Termination of O-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Protein Entry
SIA4C_HUMAN
UniProt ID
Q11206
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=7; Name=1; Synonyms=B1; IsoId=Q11206-1; Sequence=Displayed; Name=2; Synonyms=A1; IsoId=Q11206-2; Sequence=VSP_001784; Name=3; Synonyms=A2; IsoId=Q11206-3; Sequence=VSP_001785; Name=4; Synonyms=C; IsoId=Q11206-4; Sequence=VSP_001786; Name=5; IsoId=Q11206-5; Sequence=VSP_021104; Name=6; IsoId=Q11206-6; Sequence=VSP_001784, VSP_021104; Name=7; IsoId=Q11206-7; Sequence=VSP_001785, VSP_021104;
Catalytic Activity CMP-N-acetylneuraminate + beta-D-galactosyl- 1,4-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1,4-N-acetyl-D- glucosaminyl-glycoprotein.
Function It may catalyze the formation of the NeuAc-alpha-2,3- Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant. Also acts on the corresponding 1,3- galactosyl derivative.
Pathway Protein modification; protein glycosylation.
Ptm The soluble form derives from the membrane form by proteolytic processing.
Similarity Belongs to the glycosyltransferase 29 family.
Subcellular Location Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid.
Tissue Specificity Highly expressed in adult placenta, ovary and testes.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=ST3Gal IV; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_625";
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST3GAL4";

Identical and Related Proteins

Unique RefSeq proteins for LMP001000 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
5454058 RefSeq NP_006269 329 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 1 precursor
363543346 RefSeq NP_001241686 333 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2
363543350 RefSeq NP_001241688 332 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 3 precursor

Identical Sequences to LMP001000 proteins

Reference Database Accession Length Protein Name
GI:5454058 DBBJ BAG37279.1 329 unnamed protein product [Homo sapiens]
GI:5454058 EMBL CAS91691.1 329 unnamed protein product [Homo sapiens]
GI:363543350 GenBank AAA16460.1 332 a2,3 sialyltransferse [Homo sapiens]
GI:363543346 GenBank AAH10645.1 333 ST3GAL4 protein [Homo sapiens]
GI:363543350 GenBank EAW67693.1 332 ST3 beta-galactoside alpha-2,3-sialyltransferase 4, isoform CRA_a [Homo sapiens]
GI:5454058 GenBank EAW67695.1 329 ST3 beta-galactoside alpha-2,3-sialyltransferase 4, isoform CRA_c [Homo sapiens]
GI:5454058 GenBank EAW67697.1 329 ST3 beta-galactoside alpha-2,3-sialyltransferase 4, isoform CRA_c [Homo sapiens]
GI:363543346 GenBank ACE86638.1 333 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 protein, partial [synthetic construct]
GI:363543346 GenBank ACE87320.1 333 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 protein [synthetic construct]
GI:5454058 GenBank AFO15134.1 329 Sequence 618 from patent US 8211634
GI:363543346 GenBank AIC59262.1 333 ST3GAL4, partial [synthetic construct]
GI:363543346 RefSeq NP_001241687.1 333 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2 [Homo sapiens]
GI:363543346 RefSeq XP_005271707.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X3 [Homo sapiens]
GI:5454058 RefSeq XP_005271708.1 329 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X4 [Homo sapiens]

Related Sequences to LMP001000 proteins

Reference Database Accession Length Protein Name
GI:363543346 EMBL CAH90316.1 333 hypothetical protein [Pongo abelii]
GI:363543350 GenBank AAE01600.1 332 Sequence 12 from patent US 5858751
GI:363543350 GenBank AAE29759.1 332 Sequence 12 from patent US 5962294
GI:363543350 GenBank AAM81378.1 338 alpha-2,3-sialyltransferase IV type A1+18 [Homo sapiens]
GI:5454058 GenBank ACM84702.1 369 Sequence 10200 from patent US 6812339
GI:5454058 GenBank JAA27842.1 329 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Pan troglodytes]
GI:363543346 GenBank JAA27843.1 333 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Pan troglodytes]
GI:5454058 GenBank JAA35795.1 329 ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Pan troglodytes]
GI:363543346 RefSeq NP_001125146.1 333 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 [Pongo abelii]
GI:363543350 RefSeq NP_001241686.1 333 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2 [Homo sapiens]
GI:363543350 RefSeq NP_001241687.1 333 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2 [Homo sapiens]
GI:5454058 RefSeq XP_003819937.1 329 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X3 [Pan paniscus]
GI:5454058 RefSeq XP_005271706.1 352 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X2 [Homo sapiens]
GI:363543346 RefSeq XP_006718959.1 356 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X5 [Homo sapiens]
GI:363543346 RefSeq XP_006718960.1 354 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X6 [Homo sapiens]
GI:363543350 RefSeq XP_009422659.1 341 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Pan troglodytes]
GI:363543346 RefSeq XP_009422661.1 333 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X3 [Pan troglodytes]
GI:5454058 RefSeq XP_009422662.1 329 PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X4 [Pan troglodytes]