Gene/Proteome Database (LMPD)
LMPD ID
LMP001000
Gene ID
Species
Homo sapiens (Human)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Synonyms
CGS23; NANTA3; SAT3; SIAT4; SIAT4C; ST3GalIV; STZ
Alternate Names
CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4; ST-4; SAT-3; SIAT4-C; ST3GalA.2; gal-NAc6S; alpha 2,3-ST 4; alpha 2,3-sialyltransferase IV; alpha-3-N-acetylneuraminyltransferase; beta-galactoside alpha-2,3-sialyltransferase 4; gal-beta-1,4-GalNAc-alpha-2,3-sialyltransferase; sialyltransferase 4C (beta-galactoside alpha-2,3-sialytransferase); sialyltransferase 4C (beta-galactosidase alpha-2,3-sialytransferase)
Chromosome
11
Map Location
11q24.2
EC Number
2.4.99.-
Summary
This gene encodes a member of the glycosyltransferase 29 family, a group of enzymes involved in protein glycosylation. The encoded protein is targeted to Golgi membranes but may be proteolytically processed and secreted. The gene product may also be involved in the increased expression of sialyl Lewis X antigen seen in inflammatory responses. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]
Orthologs
Proteins
| CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 1 precursor | |
|---|---|
| Refseq ID | NP_006269 |
| Protein GI | 5454058 |
| UniProt ID | Q11206 |
| mRNA ID | NM_006278 |
| Length | 329 |
| RefSeq Status | VALIDATED |
| MVSKSRWKLLAMLALVLVVMVWYSISREDSFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF | |
| sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2796 peptide sequence: MCPAGWKLLAMLALVLVVMVWYSIS sig_peptide: 1..26 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3025 peptide sequence: MVSKSRWKLLAMLALVLVVMVWYSIS | |
| CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2 | |
|---|---|
| Refseq ID | NP_001241686 |
| Protein GI | 363543346 |
| UniProt ID | Q11206 |
| mRNA ID | NM_001254757 |
| Length | 333 |
| RefSeq Status | VALIDATED |
| MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF | |
| CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2 | |
|---|---|
| Refseq ID | NP_001241687 |
| Protein GI | 363543348 |
| UniProt ID | Q11206 |
| mRNA ID | NM_001254758 |
| Length | 333 |
| RefSeq Status | VALIDATED |
| Protein sequence is identical to GI:363543346 (mRNA isoform) | |
| CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 3 precursor | |
|---|---|
| Refseq ID | NP_001241688 |
| Protein GI | 363543350 |
| UniProt ID | Q11206 |
| mRNA ID | NM_001254759 |
| Length | 332 |
| RefSeq Status | VALIDATED |
| MCPAGWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000139 | TAS:Reactome | C | Golgi membrane |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0003836 | TAS:ProtInc | F | beta-galactoside (CMP) alpha-2,3-sialyltransferase activity |
| GO:0047288 | IEA:Ensembl | F | monosialoganglioside sialyltransferase activity |
| GO:0016266 | TAS:Reactome | P | O-glycan processing |
| GO:0005975 | TAS:Reactome | P | carbohydrate metabolic process |
| GO:0044267 | TAS:Reactome | P | cellular protein metabolic process |
| GO:0050890 | IMP:UniProt | P | cognition |
| GO:0030203 | TAS:Reactome | P | glycosaminoglycan metabolic process |
| GO:0018146 | TAS:Reactome | P | keratan sulfate biosynthetic process |
| GO:0042339 | TAS:Reactome | P | keratan sulfate metabolic process |
| GO:0043687 | TAS:Reactome | P | post-translational protein modification |
| GO:0018279 | TAS:Reactome | P | protein N-linked glycosylation via asparagine |
| GO:0097503 | TAS:GOC | P | sialylation |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121120 | Keratan sulfate biosynthesis |
| REACT_118798 | Pre-NOTCH Processing in Golgi |
| REACT_200874 | Sialic acid metabolism |
| REACT_115835 | Termination of O-glycan biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 4
Protein Entry
SIA4C_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=7; Name=1; Synonyms=B1; IsoId=Q11206-1; Sequence=Displayed; Name=2; Synonyms=A1; IsoId=Q11206-2; Sequence=VSP_001784; Name=3; Synonyms=A2; IsoId=Q11206-3; Sequence=VSP_001785; Name=4; Synonyms=C; IsoId=Q11206-4; Sequence=VSP_001786; Name=5; IsoId=Q11206-5; Sequence=VSP_021104; Name=6; IsoId=Q11206-6; Sequence=VSP_001784, VSP_021104; Name=7; IsoId=Q11206-7; Sequence=VSP_001785, VSP_021104; |
| Catalytic Activity | CMP-N-acetylneuraminate + beta-D-galactosyl- 1,4-N-acetyl-D-glucosaminyl-glycoprotein = CMP + alpha-N- acetylneuraminyl-2,3-beta-D-galactosyl-1,4-N-acetyl-D- glucosaminyl-glycoprotein. |
| Function | It may catalyze the formation of the NeuAc-alpha-2,3- Gal-beta-1,3-GalNAc- or NeuAc-alpha-2,3-Gal-beta-1,3-GlcNAc- sequences found in terminal carbohydrate groups of glycoproteins and glycolipids. It may be involved in the biosynthesis of the sialyl Lewis X determinant. Also acts on the corresponding 1,3- galactosyl derivative. |
| Pathway | Protein modification; protein glycosylation. |
| Ptm | The soluble form derives from the membrane form by proteolytic processing. |
| Similarity | Belongs to the glycosyltransferase 29 family. |
| Subcellular Location | Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Secreted. Note=Membrane- bound form in trans cisternae of Golgi. Secreted into the body fluid. |
| Tissue Specificity | Highly expressed in adult placenta, ovary and testes. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=ST3Gal IV; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_625"; |
| Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST3GAL4"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001000 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 5454058 | RefSeq | NP_006269 | 329 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 1 precursor |
| 363543346 | RefSeq | NP_001241686 | 333 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2 |
| 363543350 | RefSeq | NP_001241688 | 332 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 3 precursor |
Identical Sequences to LMP001000 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5454058 | DBBJ | BAG37279.1 | 329 | unnamed protein product [Homo sapiens] |
| GI:5454058 | EMBL | CAS91691.1 | 329 | unnamed protein product [Homo sapiens] |
| GI:363543350 | GenBank | AAA16460.1 | 332 | a2,3 sialyltransferse [Homo sapiens] |
| GI:363543346 | GenBank | AAH10645.1 | 333 | ST3GAL4 protein [Homo sapiens] |
| GI:363543350 | GenBank | EAW67693.1 | 332 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4, isoform CRA_a [Homo sapiens] |
| GI:5454058 | GenBank | EAW67695.1 | 329 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4, isoform CRA_c [Homo sapiens] |
| GI:5454058 | GenBank | EAW67697.1 | 329 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4, isoform CRA_c [Homo sapiens] |
| GI:363543346 | GenBank | ACE86638.1 | 333 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 protein, partial [synthetic construct] |
| GI:363543346 | GenBank | ACE87320.1 | 333 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 protein [synthetic construct] |
| GI:5454058 | GenBank | AFO15134.1 | 329 | Sequence 618 from patent US 8211634 |
| GI:363543346 | GenBank | AIC59262.1 | 333 | ST3GAL4, partial [synthetic construct] |
| GI:363543346 | RefSeq | NP_001241687.1 | 333 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2 [Homo sapiens] |
| GI:363543346 | RefSeq | XP_005271707.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X3 [Homo sapiens] |
| GI:5454058 | RefSeq | XP_005271708.1 | 329 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X4 [Homo sapiens] |
Related Sequences to LMP001000 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:363543346 | EMBL | CAH90316.1 | 333 | hypothetical protein [Pongo abelii] |
| GI:363543350 | GenBank | AAE01600.1 | 332 | Sequence 12 from patent US 5858751 |
| GI:363543350 | GenBank | AAE29759.1 | 332 | Sequence 12 from patent US 5962294 |
| GI:363543350 | GenBank | AAM81378.1 | 338 | alpha-2,3-sialyltransferase IV type A1+18 [Homo sapiens] |
| GI:5454058 | GenBank | ACM84702.1 | 369 | Sequence 10200 from patent US 6812339 |
| GI:5454058 | GenBank | JAA27842.1 | 329 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Pan troglodytes] |
| GI:363543346 | GenBank | JAA27843.1 | 333 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Pan troglodytes] |
| GI:5454058 | GenBank | JAA35795.1 | 329 | ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Pan troglodytes] |
| GI:363543346 | RefSeq | NP_001125146.1 | 333 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 [Pongo abelii] |
| GI:363543350 | RefSeq | NP_001241686.1 | 333 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2 [Homo sapiens] |
| GI:363543350 | RefSeq | NP_001241687.1 | 333 | CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform 2 [Homo sapiens] |
| GI:5454058 | RefSeq | XP_003819937.1 | 329 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X3 [Pan paniscus] |
| GI:5454058 | RefSeq | XP_005271706.1 | 352 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X2 [Homo sapiens] |
| GI:363543346 | RefSeq | XP_006718959.1 | 356 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X5 [Homo sapiens] |
| GI:363543346 | RefSeq | XP_006718960.1 | 354 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X6 [Homo sapiens] |
| GI:363543350 | RefSeq | XP_009422659.1 | 341 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X1 [Pan troglodytes] |
| GI:363543346 | RefSeq | XP_009422661.1 | 333 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X3 [Pan troglodytes] |
| GI:5454058 | RefSeq | XP_009422662.1 | 329 | PREDICTED: CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4 isoform X4 [Pan troglodytes] |