Gene/Proteome Database (LMPD)

LMPD ID
LMP001024
Gene ID
Species
Mus musculus (Mouse)
Gene Name
aldo-keto reductase family 1, member C6
Gene Symbol
Synonyms
3alpha-HSD; Akr1c1; Hsd17b5
Alternate Names
estradiol 17 beta-dehydrogenase 5; 17HSD type 5; 17-beta-HSD 5; hydroxysteroid 17-beta dehydrogenase 5; estradiol 17-beta-dehydrogenase (A-specific); aldo-keto reductase family 1, member C1 (aldehyde reductase)
Chromosome
13
Map Location
13 A2|13 2.48 cM
EC Number
1.1.1.-

Proteins

estradiol 17 beta-dehydrogenase 5
Refseq ID NP_085114
Protein GI 13487925
UniProt ID P70694
mRNA ID NM_030611
Length 323
RefSeq Status PROVISIONAL
MDSKQQTVRLSDGHFIPILGFGTYAPQEVPKSKATEATKIAIDAGFRHIDSASMYQNEKEVGLAIRSKIADGTVKREDIFYTSKVWCTFHRPELVRVCLEQSLKQLQLDYVDLYLIHFPMAMKPGENYLPKDENGKLIYDAVDICDTWEAMEKCKDAGLAKSIGVSNFNRRQLEKILKKPGLKYKPVCNQVECHPYLNQGKLLDFCRSKDIVLVAYSALGSHREKQWVDQSSPVLLDNPVLGSMAKKYNRTPALIALRYQLQRGVVVLAKSFSEKRIKENMQVFEFQLTSEDMKVLDDLNKNIRYISGSSFKDHPDFPFWDEY

Gene Information

Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member C6
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0004033 IDA:MGI F aldo-keto reductase (NADP) activity
GO:0004303 IDA:MGI F estradiol 17-beta-dehydrogenase activity
GO:0006694 IDA:MGI P steroid biosynthetic process
GO:0008202 IDA:MGI P steroid metabolic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY3DJ-35583 biosynthesis of prostaglandins

REACTOME Pathway Links

REACTOME Pathway ID Description
5893443 Synthesis of bile acids and bile salts via 24-hydroxycholesterol
5893439 Synthesis of bile acids and bile salts via 27-hydroxycholesterol
5893441 Synthesis of bile acids and bile salts via 7alpha-hydroxycholesterol

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 1, member C6
Protein Entry
DHB5_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Function Active toward androgens, estrogens, and xenobiotic substrates. Also exhibits low 20 alpha-HSD activity. Shows a- stereospecificity in hydrogen transfer between cofactors and substrates (A-specific). Preferentially catalyzes the reduction of 4-androstenedione, 5-alpha-androstane-3,17-dione, androsterone and dehydroepiandrosterone to testosterone, dihydrotestosterone, 5- alpha-androstane-3-alpha,17-beta-diol and 5-androstene-3-beta,17- beta-diol, respectively. {ECO:0000269|PubMed:10500239}.
Ptm Three forms are detected, probably due to post-translational modifications.
Similarity Belongs to the aldo/keto reductase family. {ECO:0000305}.
Subunit Monomer.
Tissue Specificity Mainly found in liver. Also expressed weakly in kidney. {ECO:0000269|PubMed:10500239}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001024 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13487925 RefSeq NP_085114 323 estradiol 17 beta-dehydrogenase 5

Identical Sequences to LMP001024 proteins

Reference Database Accession Length Protein Name
GI:13487925 DBBJ BAE28891.1 323 unnamed protein product [Mus musculus]
GI:13487925 GenBank AAH56643.1 323 Aldo-keto reductase family 1, member C6 [Mus musculus]
GI:13487925 GenBank EDL32249.1 323 mCG9091, isoform CRA_d [Mus musculus]
GI:13487925 GenBank ACQ18777.1 323 Sequence 32 from patent US 7510851
GI:13487925 GenBank ACQ18784.1 323 Sequence 41 from patent US 7510851
GI:13487925 GenBank AHE23832.1 323 Sequence 1 from patent US 8592178

Related Sequences to LMP001024 proteins

Reference Database Accession Length Protein Name
GI:13487925 DBBJ BAE94926.1 323 aldo-keto reductase [Mus musculus]
GI:13487925 GenBank AAH21607.1 323 Akr1c20 protein [Mus musculus]
GI:13487925 GenBank EDL32248.1 297 mCG9091, isoform CRA_c [Mus musculus]
GI:13487925 GenBank EDL32252.1 323 mCG9092, isoform CRA_c [Mus musculus]
GI:13487925 GenBank AHE23833.1 343 Sequence 2 from patent US 8592178
GI:13487925 RefSeq XP_006516573.1 297 PREDICTED: estradiol 17 beta-dehydrogenase 5 isoform X1 [Mus musculus]