Gene/Proteome Database (LMPD)

LMPD ID
LMP001046
Gene ID
1891
Species
Homo sapiens (Human)
Gene Name
enoyl CoA hydratase 1, peroxisomal
Gene Symbol
ECH1
Synonyms
HPXEL
Alternate Names
delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; dienoyl-CoA isomerase; peroxisomal enoyl-CoA hydratase 1; delta3,5-delta2,4-dienoyl-CoA isomerase; enoyl Coenzyme A hydratase 1, peroxisomal
Chromosome
19
Map Location
19q13.1
EC Number
5.3.3.-
Summary
This gene encodes a member of the hydratase/isomerase superfamily. The gene product shows high sequence similarity to enoyl-coenzyme A (CoA) hydratases of several species, particularly within a conserved domain characteristic of these proteins. The encoded protein, which contains a C-terminal peroxisomal targeting sequence, localizes to the peroxisome. The rat ortholog, which localizes to the matrix of both the peroxisome and mitochondria, can isomerize 3-trans,5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. This enzyme functions in the auxiliary step of the fatty acid beta-oxidation pathway. Expression of the rat gene is induced by peroxisome proliferators. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for ECH1

Proteins

delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursor
Refseq ID NP_001389
Protein GI 70995211
UniProt ID Q13011
mRNA ID NM_001398
Length 328
RefSeq Status REVIEWED
MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL

Gene Information

Entrez Gene ID
1891
Gene Name
enoyl CoA hydratase 1, peroxisomal
Gene Symbol
ECH1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0016020 IDA:UniProtKB C membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0005777 NAS:UniProtKB C peroxisome
GO:0016853 IEA:UniProtKB-KW F isomerase activity
GO:0005102 IPI:UniProtKB F receptor binding
GO:0006635 IEA:UniProtKB-UniPathway P fatty acid beta-oxidation

KEGG Pathway Links

KEGG Pathway ID Description
hsa04146 Peroxisome
ko04146 Peroxisome

Domain Information

InterPro Annotations

Accession Description
IPR029045 ClpP/crotonase-like domain
IPR014748 Crontonase, C-terminal
IPR001753 Crotonase_core_superfam
IPR018376 Enoyl-CoA hydratase/isomerase, conserved site

UniProt Annotations

Entry Information

Gene Name
enoyl CoA hydratase 1, peroxisomal
Protein Entry
ECH1_HUMAN
UniProt ID
Q13011
Species
Human

Comments

Comment Type Description
Function Isomerization of 3-trans,5-cis-dienoyl-CoA to 2-trans,4- trans-dienoyl-CoA.
Interaction P42858:HTT; NbExp=2; IntAct=EBI-711968, EBI-466029; P40763:STAT3; NbExp=2; IntAct=EBI-711968, EBI-518675;
Pathway Lipid metabolism; fatty acid beta-oxidation.
Similarity Belongs to the enoyl-CoA hydratase/isomerase family.
Subcellular Location Mitochondrion . Peroxisome .
Subunit Homohexamer.

Identical and Related Proteins

Unique RefSeq proteins for LMP001046 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
70995211 RefSeq NP_001389 328 delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial precursor

Identical Sequences to LMP001046 proteins

Reference Database Accession Length Protein Name
GI:70995211 GenBank AAH11792.1 328 Enoyl Coenzyme A hydratase 1, peroxisomal [Homo sapiens]
GI:70995211 GenBank ABM83852.1 328 enoyl Coenzyme A hydratase 1, peroxisomal [synthetic construct]
GI:70995211 GenBank ABM87174.1 328 enoyl Coenzyme A hydratase 1, peroxisomal, partial [synthetic construct]
GI:70995211 GenBank AEF74550.1 328 Sequence 25 from patent US 7939271
GI:70995211 GenBank AIC54314.1 328 ECH1, partial [synthetic construct]
GI:70995211 SwissProt Q13011.2 328 RecName: Full=Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial; Flags: Precursor [Homo sapiens]

Related Sequences to LMP001046 proteins

Reference Database Accession Length Protein Name
GI:70995211 DBBJ BAF84549.1 328 unnamed protein product [Homo sapiens]
GI:70995211 GenBank AAH17408.1 328 Enoyl Coenzyme A hydratase 1, peroxisomal [Homo sapiens]
GI:70995211 GenBank ADA19535.1 328 Sequence 1359 from patent US 7608413
GI:70995211 GenBank ADT47303.1 328 Sequence 964 from patent US 7842466
GI:70995211 GenBank ADT50115.1 328 Sequence 2132 from patent US 7842467
GI:70995211 GenBank AIC54315.1 328 ECH1, partial [synthetic construct]