Gene/Proteome Database (LMPD)
LMPD ID
LMP001064
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylserine synthase 2
Gene Symbol
Synonyms
AI481134; AI988017; PSS2
Alternate Names
phosphatidylserine synthase 2; PSS-2; ptdSer synthase 2; serine-exchange enzyme II
Chromosome
7
Map Location
7 F5|7
EC Number
2.7.8.29
Proteins
| phosphatidylserine synthase 2 | |
|---|---|
| Refseq ID | NP_038810 |
| Protein GI | 31560497 |
| UniProt ID | Q9Z1X2 |
| mRNA ID | NM_013782 |
| Length | 473 |
| RefSeq Status | PROVISIONAL |
| MRRGERRVAGGSGSESPLLKGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCALGYVTLLEETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFILFQTVQDGRQFLKYVDPRLGVPLPERDYGGNCLIYDADNKTDPFHNIWDKLDGFVPAHFIGWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLVCNGLGIYCGMKTLEWLSLKTYKWQGLWNIPTYKGKMKRIAFQFTPYSWVRFEWKPASSLHRWLAVCGIILVFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDELKPHRKLGQQAWLVAAITVTELLIVVKYDPHTLTLSLPFYISQCWTLGSILVLTWTVWRFFLRDITMRYKETRRQKQQSHQARAVNNRDGHPGPDDDLLGTGTAEEEGTTNDGVTAEEGTSAAS | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylserine synthase 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | IDA:UniProtKB | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005622 | IDA:MGI | C | intracellular |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0003882 | IMP:MGI | F | CDP-diacylglycerol-serine O-phosphatidyltransferase activity |
| GO:0006659 | IMP:MGI | P | phosphatidylserine biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004277 | Phosphatidyl serine synthase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Z1X2-1; Sequence=Displayed; Name=2; IsoId=Q9Z1X2-2; Sequence=VSP_010637, VSP_010638; |
| Catalytic Activity | L-1-phosphatidylethanolamine + L-serine = L-1- phosphatidylserine + ethanolamine. |
| Disruption Phenotype | Null mice exhibit a reduction of more than 95% in serine exchange in testis and approximately 90% reduction in brain and liver. Testis weight is reduced and some animals are infertile. Elimination of either Pss1 or Pss2, but not both, is compatible with mouse viability. Mice can tolerate as little as 10% serine-exchange activity and are viable with small amounts of phosphatidylserine and phosphatidylethanolamine content. {ECO:0000269|PubMed:12361952, ECO:0000269|PubMed:18343815}. |
| Enzyme Regulation | Almost complete inhibition by ethanolamine in both the mitochondria-associated membrane (MAM) and endoplasmic reticulum (ER) per se. {ECO:0000269|PubMed:10938271}. |
| Function | Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. PTDSS2 is specific for phosphatatidylethanolamine and does not act on phosphatidylcholine. {ECO:0000269|PubMed:10432300}. |
| Pathway | Phospholipid metabolism; phosphatidylserine biosynthesis. |
| Similarity | Belongs to the phosphatidyl serine synthase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:10938271}; Multi-pass membrane protein {ECO:0000269|PubMed:10938271}. Note=Highly enriched in the mitochondria-associated membrane (MAM). |
| Tissue Specificity | Highly expressed in testis. Detected at lower levels in kidney and heart. {ECO:0000269|PubMed:10432300, ECO:0000269|PubMed:12361952}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001064 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 31560497 | RefSeq | NP_038810 | 473 | phosphatidylserine synthase 2 |
Identical Sequences to LMP001064 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:31560497 | DBBJ | BAC29399.1 | 473 | unnamed protein product [Mus musculus] |
| GI:31560497 | DBBJ | BAC38180.1 | 473 | unnamed protein product [Mus musculus] |
| GI:31560497 | GenBank | AAH53517.1 | 473 | Phosphatidylserine synthase 2 [Mus musculus] |
| GI:31560497 | GenBank | EDL18001.1 | 473 | phosphatidylserine synthase 2, isoform CRA_d [Mus musculus] |
| GI:31560497 | SwissProt | Q9Z1X2.2 | 473 | RecName: Full=Phosphatidylserine synthase 2; Short=PSS-2; Short=PtdSer synthase 2; AltName: Full=Serine-exchange enzyme II [Mus musculus] |
Related Sequences to LMP001064 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:31560497 | GenBank | AAC98383.1 | 473 | phosphatidylserine synthase-2 [Mus musculus] |
| GI:31560497 | GenBank | AAO00503.1 | 473 | Sequence 5 from patent US 6489152 |
| GI:31560497 | GenBank | ABC03633.1 | 473 | Sequence 9 from patent US 6953682 |
| GI:31560497 | GenBank | EDM11981.1 | 471 | phosphatidylserine synthase 2 (predicted), isoform CRA_d [Rattus norvegicus] |
| GI:31560497 | GenBank | AAI66496.1 | 471 | Phosphatidylserine synthase 2 [Rattus norvegicus] |
| GI:31560497 | RefSeq | NP_001099786.1 | 471 | phosphatidylserine synthase 2 [Rattus norvegicus] |