Gene/Proteome Database (LMPD)
LMPD ID
LMP001110
Gene ID
Species
Mus musculus (Mouse)
Gene Name
estrogen receptor 1 (alpha)
Gene Symbol
Synonyms
ER; ER-alpha; ERa; ERalpha; ESR; Estr; Estra; Nr3a1
Chromosome
10
Map Location
10 A1|10 2.03 cM
Summary
This gene encodes an estrogen receptor, a member of the nuclear hormone family of intracellular receptors. The encoded protein, activated by the sex hormone estrogen, is a transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Similar genes in human have been implicated in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
Orthologs
Proteins
| estrogen receptor isoform 1 | |
|---|---|
| Refseq ID | NP_031982 |
| Protein GI | 6679695 |
| UniProt ID | P19785 |
| mRNA ID | NM_007956 |
| Length | 599 |
| RefSeq Status | REVIEWED |
| MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:MGI | C | cytoplasm |
| GO:0005634 | IDA:MGI | C | nucleus |
| GO:0005886 | IEA:Ensembl | C | plasma membrane |
| GO:0000978 | IEA:Ensembl | F | RNA polymerase II core promoter proximal region sequence-specific DNA binding |
| GO:0001077 | IEA:Ensembl | F | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription |
| GO:0003682 | IDA:MGI | F | chromatin binding |
| GO:0001046 | IEA:Ensembl | F | core promoter sequence-specific DNA binding |
| GO:0034056 | IEA:Ensembl | F | estrogen response element binding |
| GO:0038052 | IEA:Ensembl | F | estrogen-activated sequence-specific DNA binding RNA polymerase II transcription factor activity |
| GO:0004879 | IDA:MGI | F | ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity |
| GO:0005496 | IEA:UniProtKB-KW | F | steroid binding |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0008209 | IMP:MGI | P | androgen metabolic process |
| GO:0001547 | IMP:MGI | P | antral ovarian follicle growth |
| GO:0071391 | IMP:MGI | P | cellular response to estrogen stimulus |
| GO:0002064 | IMP:MGI | P | epithelial cell development |
| GO:0060750 | IMP:MGI | P | epithelial cell proliferation involved in mammary gland duct elongation |
| GO:0030522 | IDA:GOC | P | intracellular receptor signaling pathway |
| GO:0008584 | IMP:MGI | P | male gonad development |
| GO:0060749 | IMP:MGI | P | mammary gland alveolus development |
| GO:0060745 | IMP:MGI | P | mammary gland branching involved in pregnancy |
| GO:0043124 | IEA:Ensembl | P | negative regulation of I-kappaB kinase/NF-kappaB signaling |
| GO:0010629 | IEA:Ensembl | P | negative regulation of gene expression |
| GO:0043433 | IEA:Ensembl | P | negative regulation of sequence-specific DNA binding transcription factor activity |
| GO:0048146 | IMP:MGI | P | positive regulation of fibroblast proliferation |
| GO:0045429 | IEA:Ensembl | P | positive regulation of nitric oxide biosynthetic process |
| GO:0051000 | IEA:Ensembl | P | positive regulation of nitric-oxide synthase activity |
| GO:0048386 | IEA:Ensembl | P | positive regulation of retinoic acid receptor signaling pathway |
| GO:0051091 | IEA:Ensembl | P | positive regulation of sequence-specific DNA binding transcription factor activity |
| GO:0045944 | IMP:MGI | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0060527 | IMP:MGI | P | prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis |
| GO:0060523 | IMP:MGI | P | prostate epithelial cord elongation |
| GO:0042981 | IMP:MGI | P | regulation of apoptotic process |
| GO:0060687 | IMP:MGI | P | regulation of branching involved in prostate gland morphogenesis |
| GO:0006355 | IDA:MGI | P | regulation of transcription, DNA-templated |
| GO:0032355 | IEA:Ensembl | P | response to estradiol |
| GO:0060065 | IGI:MGI | P | uterus development |
| GO:0060068 | IGI:MGI | P | vagina development |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008946 | Nuclear hormone receptor, ligand-binding |
| IPR000536 | Nuclear hormone receptor, ligand-binding, core |
| IPR001292 | Oestrogen receptor |
| IPR024178 | Oestrogen receptor/oestrogen-related receptor |
| IPR024736 | Oestrogen-type nuclear receptor final C-terminal domain |
| IPR001723 | Steroid hormone receptor |
| IPR013088 | Zinc finger, NHR/GATA-type |
| IPR001628 | Zinc finger, nuclear hormone receptor-type |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues. |
| Similarity | Belongs to the nuclear hormone receptor family. |
| Similarity | Belongs to the nuclear hormone receptor family. NR3 subfamily. |
| Similarity | Contains nuclear receptor DNA-binding domain. |
| Subcellular Location | Nucleus . |
| Subunit | Binds DNA as a homodimer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001110 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6679695 | RefSeq | NP_031982 | 599 | estrogen receptor isoform 1 |
Identical Sequences to LMP001110 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6679695 | GenBank | AGV91516.1 | 599 | Sequence 72 from patent US 8530168 |
| GI:6679695 | RefSeq | XP_006512496.1 | 599 | PREDICTED: estrogen receptor isoform X2 [Mus musculus] |
| GI:6679695 | RefSeq | XP_006512497.1 | 599 | PREDICTED: estrogen receptor isoform X3 [Mus musculus] |
| GI:6679695 | RefSeq | XP_006512498.1 | 599 | PREDICTED: estrogen receptor isoform X4 [Mus musculus] |
| GI:6679695 | RefSeq | NP_001289460.1 | 599 | estrogen receptor isoform 1 [Mus musculus] |
| GI:6679695 | RefSeq | NP_001289461.1 | 599 | estrogen receptor isoform 1 [Mus musculus] |
Related Sequences to LMP001110 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6679695 | GenBank | EDL92854.1 | 600 | rCG41136, isoform CRA_a [Rattus norvegicus] |
| GI:6679695 | GenBank | EDL92855.1 | 600 | rCG41136, isoform CRA_a [Rattus norvegicus] |
| GI:6679695 | GenBank | EDL92857.1 | 600 | rCG41136, isoform CRA_a [Rattus norvegicus] |
| GI:6679695 | GenBank | EDL92858.1 | 600 | rCG41136, isoform CRA_a [Rattus norvegicus] |
| GI:6679695 | GenBank | ACF17956.1 | 596 | estrogen receptor alpha variant U2 [Mus musculus] |
| GI:6679695 | GenBank | ACF17958.1 | 596 | estrogen receptor alpha variant U1 [Mus musculus] |