Gene/Proteome Database (LMPD)

LMPD ID
LMP001110
Gene ID
13982
Species
Mus musculus (Mouse)
Gene Name
estrogen receptor 1 (alpha)
Gene Symbol
Esr1
Synonyms
ER; ER-alpha; ERa; ERalpha; ESR; Estr; Estra; Nr3a1
Chromosome
10
Map Location
10 A1|10 2.03 cM
Summary
This gene encodes an estrogen receptor, a member of the nuclear hormone family of intracellular receptors. The encoded protein, activated by the sex hormone estrogen, is a transcription factor composed of several domains important for hormone binding, DNA binding, and activation of transcription. Estrogen and its receptors are essential for sexual development and reproductive function, but also play a role in other tissues such as bone. Similar genes in human have been implicated in pathological processes including breast cancer, endometrial cancer, and osteoporosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
Orthologs
View orthologs and multiple alignments for Esr1

Proteins

estrogen receptor isoform 1
Refseq ID NP_031982
Protein GI 6679695
UniProt ID P19785
mRNA ID NM_007956
Length 599
RefSeq Status REVIEWED
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAYEFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQLSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIMESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPLVIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVHMINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPLYDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI

Gene Information

Entrez Gene ID
13982
Gene Name
estrogen receptor 1 (alpha)
Gene Symbol
Esr1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:MGI C cytoplasm
GO:0005634 IDA:MGI C nucleus
GO:0005886 IEA:Ensembl C plasma membrane
GO:0000978 IEA:Ensembl F RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001077 IEA:Ensembl F RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0003682 IDA:MGI F chromatin binding
GO:0001046 IEA:Ensembl F core promoter sequence-specific DNA binding
GO:0034056 IEA:Ensembl F estrogen response element binding
GO:0038052 IEA:Ensembl F estrogen-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0004879 IDA:MGI F ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0005496 IEA:UniProtKB-KW F steroid binding
GO:0008270 IEA:InterPro F zinc ion binding
GO:0008209 IMP:MGI P androgen metabolic process
GO:0001547 IMP:MGI P antral ovarian follicle growth
GO:0071391 IMP:MGI P cellular response to estrogen stimulus
GO:0002064 IMP:MGI P epithelial cell development
GO:0060750 IMP:MGI P epithelial cell proliferation involved in mammary gland duct elongation
GO:0030522 IDA:GOC P intracellular receptor signaling pathway
GO:0008584 IMP:MGI P male gonad development
GO:0060749 IMP:MGI P mammary gland alveolus development
GO:0060745 IMP:MGI P mammary gland branching involved in pregnancy
GO:0043124 IEA:Ensembl P negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0010629 IEA:Ensembl P negative regulation of gene expression
GO:0043433 IEA:Ensembl P negative regulation of sequence-specific DNA binding transcription factor activity
GO:0048146 IMP:MGI P positive regulation of fibroblast proliferation
GO:0045429 IEA:Ensembl P positive regulation of nitric oxide biosynthetic process
GO:0051000 IEA:Ensembl P positive regulation of nitric-oxide synthase activity
GO:0048386 IEA:Ensembl P positive regulation of retinoic acid receptor signaling pathway
GO:0051091 IEA:Ensembl P positive regulation of sequence-specific DNA binding transcription factor activity
GO:0045944 IMP:MGI P positive regulation of transcription from RNA polymerase II promoter
GO:0060527 IMP:MGI P prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis
GO:0060523 IMP:MGI P prostate epithelial cord elongation
GO:0042981 IMP:MGI P regulation of apoptotic process
GO:0060687 IMP:MGI P regulation of branching involved in prostate gland morphogenesis
GO:0006355 IDA:MGI P regulation of transcription, DNA-templated
GO:0032355 IEA:Ensembl P response to estradiol
GO:0060065 IGI:MGI P uterus development
GO:0060068 IGI:MGI P vagina development

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR001292 Oestrogen receptor
IPR024178 Oestrogen receptor/oestrogen-related receptor
IPR024736 Oestrogen-type nuclear receptor final C-terminal domain
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
estrogen receptor 1 (alpha)
Protein Entry
ESR1_MOUSE
UniProt ID
P19785
Species
Mouse

Comments

Comment Type Description
Function The steroid hormones and their receptors are involved in the regulation of eukaryotic gene expression and affect cellular proliferation and differentiation in target tissues.
Similarity Belongs to the nuclear hormone receptor family.
Similarity Belongs to the nuclear hormone receptor family. NR3 subfamily.
Similarity Contains nuclear receptor DNA-binding domain.
Subcellular Location Nucleus .
Subunit Binds DNA as a homodimer.

Identical and Related Proteins

Unique RefSeq proteins for LMP001110 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6679695 RefSeq NP_031982 599 estrogen receptor isoform 1

Identical Sequences to LMP001110 proteins

Reference Database Accession Length Protein Name
GI:6679695 GenBank AGV91516.1 599 Sequence 72 from patent US 8530168
GI:6679695 RefSeq XP_006512496.1 599 PREDICTED: estrogen receptor isoform X2 [Mus musculus]
GI:6679695 RefSeq XP_006512497.1 599 PREDICTED: estrogen receptor isoform X3 [Mus musculus]
GI:6679695 RefSeq XP_006512498.1 599 PREDICTED: estrogen receptor isoform X4 [Mus musculus]
GI:6679695 RefSeq NP_001289460.1 599 estrogen receptor isoform 1 [Mus musculus]
GI:6679695 RefSeq NP_001289461.1 599 estrogen receptor isoform 1 [Mus musculus]

Related Sequences to LMP001110 proteins

Reference Database Accession Length Protein Name
GI:6679695 GenBank EDL92854.1 600 rCG41136, isoform CRA_a [Rattus norvegicus]
GI:6679695 GenBank EDL92855.1 600 rCG41136, isoform CRA_a [Rattus norvegicus]
GI:6679695 GenBank EDL92857.1 600 rCG41136, isoform CRA_a [Rattus norvegicus]
GI:6679695 GenBank EDL92858.1 600 rCG41136, isoform CRA_a [Rattus norvegicus]
GI:6679695 GenBank ACF17956.1 596 estrogen receptor alpha variant U2 [Mus musculus]
GI:6679695 GenBank ACF17958.1 596 estrogen receptor alpha variant U1 [Mus musculus]