Gene/Proteome Database (LMPD)
LMPD ID
LMP001172
Gene ID
Species
Homo sapiens (Human)
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa)
Gene Symbol
Synonyms
HEL-S-303
Alternate Names
platelet-activating factor acetylhydrolase IB subunit beta; PAFAH subunit beta; PAF-AH subunit beta; PAF-AH 30 kDa subunit; PAF-AH1b alpha 2 subunit; PAF acetylhydrolase 30 kDa subunit; epididymis secretory protein Li 303; intracellular platelet-activating factor acetylhydrolase alpha 2 subunit; platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa)
Chromosome
11
Map Location
11q23
EC Number
3.1.1.47
Summary
Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2014]
Orthologs
Proteins
platelet-activating factor acetylhydrolase IB subunit beta isoform a | |
---|---|
Refseq ID | NP_002563 |
Protein GI | 4505585 |
UniProt ID | P68402 |
mRNA ID | NM_002572 |
Length | 229 |
RefSeq Status | VALIDATED |
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA |
platelet-activating factor acetylhydrolase IB subunit beta isoform b | |
---|---|
Refseq ID | NP_001171675 |
Protein GI | 296080766 |
UniProt ID | P68402 |
mRNA ID | NM_001184746 |
Length | 202 |
RefSeq Status | VALIDATED |
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGKAAASKYSISEIVRLEQGSVNWSIGTYPDDTPATTRPAILQLFTGKMSRITMKEKSRWTEEILH |
platelet-activating factor acetylhydrolase IB subunit beta isoform c | |
---|---|
Refseq ID | NP_001171676 |
Protein GI | 296080768 |
UniProt ID | P68402 |
mRNA ID | NM_001184747 |
Length | 155 |
RefSeq Status | VALIDATED |
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLIIYWQDEQDYHERKVQMD |
platelet-activating factor acetylhydrolase IB subunit beta isoform d | |
---|---|
Refseq ID | NP_001171677 |
Protein GI | 296080770 |
UniProt ID | P68402 |
mRNA ID | NM_001184748 |
Length | 132 |
RefSeq Status | VALIDATED |
MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQA |
Gene Information
Entrez Gene ID
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | TAS:UniProtKB | C | cytoplasm |
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
GO:0005730 | IDA:HPA | C | nucleolus |
GO:0005886 | IDA:HPA | C | plasma membrane |
GO:0003847 | IEA:UniProtKB-EC | F | 1-alkyl-2-acetylglycerophosphocholine esterase activity |
GO:0007420 | IEA:Ensembl | P | brain development |
GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
GO:0006629 | TAS:ProtInc | P | lipid metabolic process |
GO:0016239 | IMP:BHF-UCL | P | positive regulation of macroautophagy |
GO:0007283 | IEA:Ensembl | P | spermatogenesis |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR013831 | SGNH_hydro-type_esterase_dom |
UniProt Annotations
Entry Information
Gene Name
platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa)
Protein Entry
PA1B2_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P68402-1; Sequence=Displayed; Name=2; IsoId=P68402-2; Sequence=VSP_042896; Name=3; IsoId=P68402-3; Sequence=VSP_043217; Name=4; IsoId=P68402-4; Sequence=VSP_044680; Note=Ref.2 (ABI58227/ABI58228) sequences are in conflict in position: 151:V->M. {ECO:0000305}; |
Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=P68402-1; Sequence=Displayed; Name=2; IsoId=P68402-2; Sequence=VSP_042896; Name=3; IsoId=P68402-3; Sequence=VSP_043217; Name=4; IsoId=P68402-4; Sequence=VSP_044680; Note=Ref.2 (ABI58227/ABI58228) sequences are in conflict in position: 151:V->M. ; |
Catalytic Activity | 1-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H(2)O = 1-alkyl-sn-glycero-3-phosphocholine + acetate. |
Function | Inactivates PAF by removing the acetyl group at the sn-2 position. This is a catalytic subunit. |
Similarity | Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. |
Similarity | Belongs to the 'GDSL' lipolytic enzyme family. Platelet-activating factor acetylhydrolase IB beta/gamma subunits subfamily. {ECO:0000305}. |
Subcellular Location | Cytoplasm. |
Subunit | Cytosolic PAF-AH IB is formed of three subunits of 45 kDa (alpha), 30 kDa (beta) and 29 kDa (gamma). The catalytic activity of the enzyme resides in the beta and gamma subunits, whereas the alpha subunit has regulatory activity. Trimer formation is not essential for the catalytic activity. |
Tissue Specificity | Ubiquitous. |
Tissue Specificity | Ubiquitous. {ECO:0000269|PubMed:9144386}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001172 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
4505585 | RefSeq | NP_002563 | 229 | platelet-activating factor acetylhydrolase IB subunit beta isoform a |
296080766 | RefSeq | NP_001171675 | 202 | platelet-activating factor acetylhydrolase IB subunit beta isoform b |
296080768 | RefSeq | NP_001171676 | 155 | platelet-activating factor acetylhydrolase IB subunit beta isoform c |
296080770 | RefSeq | NP_001171677 | 132 | platelet-activating factor acetylhydrolase IB subunit beta isoform d |
Identical Sequences to LMP001172 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:296080770 | GenBank | ABI58225.1 | 132 | intracellular platelet-activating factor acetylhydrolase alpha 2 subunit variant 5 [Homo sapiens] |
GI:296080768 | GenBank | ABI58226.1 | 155 | intracellular platelet-activating factor acetylhydrolase alpha 2 subunit variant 4 [Homo sapiens] |
GI:296080768 | GenBank | ABI58229.1 | 155 | intracellular platelet-activating factor acetylhydrolase alpha 2 subunit variant 1 [Homo sapiens] |
GI:4505585 | GenBank | AIC49335.1 | 229 | PAFAH1B2, partial [synthetic construct] |
GI:4505585 | RefSeq | XP_008148351.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Eptesicus fuscus] |
GI:4505585 | RefSeq | XP_008259129.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Oryctolagus cuniculus] |
GI:4505585 | RefSeq | XP_008688260.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Ursus maritimus] |
GI:4505585 | RefSeq | XP_008849153.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Nannospalax galili] |
GI:296080770 | RefSeq | XP_008971767.1 | 132 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X2 [Pan paniscus] |
GI:4505585 | RefSeq | XP_010365705.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Rhinopithecus roxellana] |
Related Sequences to LMP001172 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:296080770 | DBBJ | BAC56453.1 | 148 | similar to platelet-activating factor acetylhydrolase, beta subunit, partial [Bos taurus] |
GI:296080770 | GenBank | AAC27974.1 | 229 | platelet-activating factor acetylhydrolase alpha 2 subunit [Rattus norvegicus] |
GI:296080766 | GenBank | ABI58227.1 | 202 | intracellular platelet-activating factor acetylhydrolase alpha 2 subunit variant 3 [Homo sapiens] |
GI:296080766 | GenBank | ABI58228.1 | 202 | intracellular platelet-activating factor acetylhydrolase alpha 2 subunit variant 2 [Homo sapiens] |
GI:4505585 | GenBank | AES03481.1 | 282 | platelet-activating factor acetylhydrolase, isoform Ib, subunit 2, partial [Mustela putorius furo] |
GI:4505585 | GenBank | ELK11884.1 | 234 | Platelet-activating factor acetylhydrolase IB subunit beta [Pteropus alecto] |
GI:4505585 | RefSeq | XP_004427343.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta [Ceratotherium simum simum] |
GI:4505585 | RefSeq | XP_004791449.1 | 242 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Mustela putorius furo] |
GI:4505585 | RefSeq | XP_005579796.1 | 242 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Macaca fascicularis] |
GI:296080770 | RefSeq | XP_006243019.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
GI:296080766 | RefSeq | XP_006243019.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
GI:296080768 | RefSeq | XP_006243019.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
GI:296080766 | RefSeq | XP_006243020.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
GI:296080770 | RefSeq | XP_006243020.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
GI:296080768 | RefSeq | XP_006243020.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Rattus norvegicus] |
GI:296080770 | RefSeq | XP_006510147.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X4 [Mus musculus] |
GI:296080766 | RefSeq | XP_006510147.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X4 [Mus musculus] |
GI:296080770 | RefSeq | XP_006510148.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X5 [Mus musculus] |
GI:296080768 | RefSeq | XP_007080480.1 | 166 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X2 [Panthera tigris altaica] |
GI:4505585 | RefSeq | XP_008019178.1 | 237 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Chlorocebus sabaeus] |
GI:296080766 | RefSeq | XP_009245375.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Pongo abelii] |
GI:296080768 | RefSeq | XP_009245375.1 | 229 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X1 [Pongo abelii] |
GI:296080768 | RefSeq | XP_009245376.1 | 186 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X2 [Pongo abelii] |
GI:296080768 | RefSeq | XP_010332814.1 | 151 | PREDICTED: platelet-activating factor acetylhydrolase IB subunit beta isoform X3 [Saimiri boliviensis boliviensis] |