Gene/Proteome Database (LMPD)
LMPD ID
LMP001176
Gene ID
Species
Homo sapiens (Human)
Gene Name
serine palmitoyltransferase, long chain base subunit 1
Gene Symbol
Synonyms
HSAN1; HSN1; LBC1; LCB1; SPT1; SPTI
Alternate Names
serine palmitoyltransferase 1; LCB 1; SPT 1; serine C-palmitoyltransferase; serine-palmitoyl-CoA transferase 1; long chain base biosynthesis protein 1
Chromosome
9
Map Location
9q22.2
EC Number
2.3.1.50
Summary
This gene encodes a member of the class-II pyridoxal-phosphate-dependent aminotransferase family. The encoded protein is the long chain base subunit 1 of serine palmitoyltransferase. Serine palmitoyltransferase converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate and is the key enzyme in sphingolipid biosynthesis. Mutations in this gene were identified in patients with hereditary sensory neuropathy type 1. Alternatively spliced variants encoding different isoforms have been identified. Pseudogenes of this gene have been defined on chromosomes 1, 6, 10, and 13. [provided by RefSeq, Jul 2013]
Orthologs
Proteins
| serine palmitoyltransferase 1 isoform a | |
|---|---|
| Refseq ID | NP_006406 |
| Protein GI | 5454084 |
| UniProt ID | O15269 |
| mRNA ID | NM_006415 |
| Length | 473 |
| RefSeq Status | REVIEWED |
| MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPSIRVVVTVEQTEEELERAASTIKEVAQAVLL | |
| serine palmitoyltransferase 1 isoform b | |
|---|---|
| Refseq ID | NP_847894 |
| Protein GI | 30474871 |
| UniProt ID | O15269 |
| mRNA ID | NM_178324 |
| Length | 143 |
| RefSeq Status | REVIEWED |
| MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFE | |
| serine palmitoyltransferase 1 isoform c | |
|---|---|
| Refseq ID | NP_001268232 |
| Protein GI | 526252798 |
| UniProt ID | O15269 |
| mRNA ID | NM_001281303 |
| Length | 513 |
| RefSeq Status | REVIEWED |
| MATATEQWVLVEMVQALYEAPAYHLILEGILILWIIRLLFSKTYKLQERSDLTVKEKEELIEEWQPEPLVPPVPKDHPALNYNIVSGPPSHKTVVNGKECINFASFNFLGLLDNPRVKAAALASLKKYGVGTCGPRGFYGTFDVHLDLEDRLAKFMKTEEAIIYSYGFATIASAIPAYSKRGDIVFVDRAACFAIQKGLQASRSDIKLFKHNDMADLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLISANMENALASIGGFCCGRSFVIDHQRLSGQGYCFSASLPPLLAAAAIEALNIMEENPGIFAVLKEKCGQIHKALQGISGLKVVGESLSPAFHLQLEESTGSREQDVRLLQEIVDQCMNRSIALTQARYLEKEEKCLPPPRGRTGESCVHHQGGSPGRPALGRVPGPWPPATQHAERTQDSRWPWSGLKESKNMWIFDRIVTKWCQYGPIV | |
Gene Information
Entrez Gene ID
Gene Name
serine palmitoyltransferase, long chain base subunit 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0035339 | IDA:UniProtKB | C | SPOTS complex |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0017059 | IDA:UniProtKB | C | serine C-palmitoyltransferase complex |
| GO:0030170 | IEA:InterPro | F | pyridoxal phosphate binding |
| GO:0004758 | IDA:UniProtKB | F | serine C-palmitoyltransferase activity |
| GO:0046513 | IEA:Ensembl | P | ceramide biosynthetic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0046511 | IEA:Ensembl | P | sphinganine biosynthetic process |
| GO:0030148 | TAS:UniProtKB | P | sphingolipid biosynthetic process |
| GO:0006665 | TAS:Reactome | P | sphingolipid metabolic process |
| GO:0006686 | IEA:Ensembl | P | sphingomyelin biosynthetic process |
| GO:0046512 | IEA:Ensembl | P | sphingosine biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY3DJ-12 | ceramide biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_115810 | Sphingolipid de novo biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
serine palmitoyltransferase, long chain base subunit 1
Protein Entry
SPTC1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O15269-1; Sequence=Displayed; Name=2; IsoId=O15269-2; Sequence=VSP_043127, VSP_043128; Note=No experimental confirmation available.; |
| Biophysicochemical Properties | Kinetic parameters: KM=0.75 mM for serine ; Vmax=1350 pmol/min/mg enzyme ; |
| Catalytic Activity | Palmitoyl-CoA + L-serine = CoA + 3-dehydro-D- sphinganine + CO(2). |
| Caution | Variant Ala-387 has been originally thought to cause HSAN1A (PubMed:15037712). Subsequently, it has been shown to be a rare, benign polymorphism found in homozygous state in a healthy individual (PubMed:19132419). {ECO |
| Cofactor | Name=pyridoxal 5'-phosphate; Xref=ChEBI |
| Disease | Neuropathy, hereditary sensory and autonomic, 1A (HSAN1A) [MIM |
| Function | Serine palmitoyltransferase (SPT). The heterodimer formed with SPTLC2 or SPTLC3 constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2-SPTSSA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC3-SPTSSA isozyme uses both C14-CoA and C16-CoA as substrates, with a slight preference for C14-CoA. The SPTLC1- SPTLC2-SPTSSB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference. |
| Pathway | Lipid metabolism; sphingolipid metabolism. |
| Ptm | Phosphorylation at Tyr-164 inhibits activity and promotes cell survival. |
| Similarity | Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO |
| Subunit | Heterodimer with SPTLC2 or SPTLC3. Component of the serine palmitoyltransferase (SPT) complex, composed of SPTLC1, either SPTLC2 or SPTLC3, and either SPTSSA or SPTSSB. Interacts with SPTSSA and SPTSSB; the interaction is direct. Interacts with ORMDL3. {ECO |
| Tissue Specificity | Widely expressed. Not detected in small intestine. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001176 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 5454084 | RefSeq | NP_006406 | 473 | serine palmitoyltransferase 1 isoform a |
| 30474871 | RefSeq | NP_847894 | 143 | serine palmitoyltransferase 1 isoform b |
| 526252798 | RefSeq | NP_001268232 | 513 | serine palmitoyltransferase 1 isoform c |
Identical Sequences to LMP001176 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5454084 | DBBJ | BAF84235.1 | 473 | unnamed protein product [Homo sapiens] |
| GI:5454084 | GenBank | AAK29328.1 | 473 | serine palmitoyltransferase [Homo sapiens] |
| GI:30474871 | GenBank | AAH07085.1 | 143 | Serine palmitoyltransferase, long chain base subunit 1 [Homo sapiens] |
| GI:5454084 | GenBank | EAW62804.1 | 473 | serine palmitoyltransferase, long chain base subunit 1, isoform CRA_a [Homo sapiens] |
| GI:5454084 | GenBank | EAW62805.1 | 473 | serine palmitoyltransferase, long chain base subunit 1, isoform CRA_a [Homo sapiens] |
| GI:526252798 | GenBank | EAW62806.1 | 513 | serine palmitoyltransferase, long chain base subunit 1, isoform CRA_b [Homo sapiens] |
| GI:5454084 | GenBank | ACM84322.1 | 473 | Sequence 9820 from patent US 6812339 |
| GI:5454084 | GenBank | AHD80177.1 | 473 | Sequence 31642 from patent US 8586006 |
| GI:30474871 | GenBank | AHD80178.1 | 143 | Sequence 31643 from patent US 8586006 |
Related Sequences to LMP001176 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30474871 | DBBJ | BAF84235.1 | 473 | unnamed protein product [Homo sapiens] |
| GI:5454084 | DBBJ | BAK62056.1 | 473 | serine palmitoyltransferase 1 [Pan troglodytes] |
| GI:30474871 | EMBL | CAA69941.1 | 473 | serine palmitoyltransferase, subunit I [Homo sapiens] |
| GI:526252798 | GenBank | AAH68537.1 | 513 | SPTLC1 protein [Homo sapiens] |
| GI:30474871 | GenBank | EAW62805.1 | 473 | serine palmitoyltransferase, long chain base subunit 1, isoform CRA_a [Homo sapiens] |
| GI:30474871 | GenBank | ACM84322.1 | 473 | Sequence 9820 from patent US 6812339 |
| GI:526252798 | GenBank | AFL44413.1 | 513 | Sequence 5 from patent US 8183005 |
| GI:5454084 | GenBank | JAA02106.1 | 473 | serine palmitoyltransferase, long chain base subunit 1 [Pan troglodytes] |
| GI:5454084 | GenBank | JAA13390.1 | 473 | serine palmitoyltransferase, long chain base subunit 1 [Pan troglodytes] |
| GI:5454084 | GenBank | JAA22994.1 | 473 | serine palmitoyltransferase, long chain base subunit 1 [Pan troglodytes] |
| GI:5454084 | GenBank | JAA38378.1 | 473 | serine palmitoyltransferase, long chain base subunit 1 [Pan troglodytes] |
| GI:526252798 | GenBank | AIC59652.1 | 513 | SPTLC1, partial [synthetic construct] |
| GI:30474871 | RefSeq | NP_006406.1 | 473 | serine palmitoyltransferase 1 isoform a [Homo sapiens] |
| GI:526252798 | RefSeq | XP_003938246.1 | 513 | PREDICTED: serine palmitoyltransferase 1 isoform X2 [Saimiri boliviensis boliviensis] |
| GI:5454084 | RefSeq | NP_001267361.1 | 473 | serine palmitoyltransferase 1 [Pan troglodytes] |
| GI:526252798 | RefSeq | XP_005582295.1 | 479 | PREDICTED: uncharacterized LOC101864870 isoform X2 [Macaca fascicularis] |
| GI:526252798 | RefSeq | XP_008256154.1 | 534 | PREDICTED: serine palmitoyltransferase 1 isoform X2 [Oryctolagus cuniculus] |
| GI:30474871 | SwissProt | O15269.1 | 473 | RecName: Full=Serine palmitoyltransferase 1; AltName: Full=Long chain base biosynthesis protein 1; Short=LCB 1; AltName: Full=Serine-palmitoyl-CoA transferase 1; Short=SPT 1; Short=SPT1 [Homo sapiens] |