Gene/Proteome Database (LMPD)

LMPD ID
LMP001221
Gene ID
4706
Species
Homo sapiens (Human)
Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa
Gene Symbol
NDUFAB1
Synonyms
ACP; FASN2A; SDAP
Alternate Names
acyl carrier protein, mitochondrial; CI-SDAP; complex I SDAP subunit; mitochondrial acyl carrier protein; NADH:ubiquinone oxidoreductase SDAP subunit; NADH-ubiquinone oxidoreductase 9.6 kDa subunit
Chromosome
16
Map Location
16p12.2

Proteins

acyl carrier protein, mitochondrial precursor
Refseq ID NP_004994
Protein GI 4826852
UniProt ID O14561
mRNA ID NM_005003
Length 156
RefSeq Status VALIDATED
MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE
transit_peptide: 1..68 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (O14561.3) calculated_mol_wt: 7266 peptide sequence: MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQY mat_peptide: 69..156 product: Acyl carrier protein, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (O14561.3) calculated_mol_wt: 10170 peptide sequence: SDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Gene Information

Entrez Gene ID
4706
Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa
Gene Symbol
NDUFAB1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005743 TAS:Reactome C mitochondrial inner membrane
GO:0005759 ISS:UniProtKB C mitochondrial matrix
GO:0031966 ISS:UniProtKB C mitochondrial membrane
GO:0005747 IDA:UniProtKB C mitochondrial respiratory chain complex I
GO:0000036 NAS:UniProtKB F ACP phosphopantetheine attachment site binding involved in fatty acid biosynthetic process
GO:0008137 NAS:UniProtKB F NADH dehydrogenase (ubiquinone) activity
GO:0005509 NAS:UniProtKB F calcium ion binding
GO:0005504 ISS:UniProtKB F fatty acid binding
GO:0044237 TAS:Reactome P cellular metabolic process
GO:0006633 NAS:UniProtKB P fatty acid biosynthetic process
GO:0006120 NAS:UniProtKB P mitochondrial electron transport, NADH to ubiquinone
GO:0009249 IMP:UniProtKB P protein lipoylation
GO:0022904 TAS:Reactome P respiratory electron transport chain
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa05010 Alzheimer's disease
hsa05016 Huntington's disease
hsa04932 Non-alcoholic fatty liver disease (NAFLD)
hsa05012 Parkinson's disease

Domain Information

InterPro Annotations

Accession Description
IPR003231 Acyl carrier protein (ACP)
IPR009081 Acyl carrier protein-like
IPR006162 Phosphopantetheine attachment site

UniProt Annotations

Entry Information

Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa
Protein Entry
ACPM_HUMAN
UniProt ID
O14561
Species
Human

Comments

Comment Type Description
Function Carrier of the growing fatty acid chain in fatty acid biosynthesis in mitochondria. Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (By similarity).
Sequence Caution Sequence=AAC05814.1; Type=Erroneous initiation; Evidence= ;
Similarity Contains 1 acyl carrier domain.
Subcellular Location Mitochondrion.
Subunit Mammalian complex I is composed of 45 different subunits.

Identical and Related Proteins

Unique RefSeq proteins for LMP001221 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4826852 RefSeq NP_004994 156 acyl carrier protein, mitochondrial precursor

Identical Sequences to LMP001221 proteins

Reference Database Accession Length Protein Name
GI:4826852 DBBJ BAG34818.1 156 unnamed protein product [Homo sapiens]
GI:4826852 GenBank JAA11530.1 156 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa [Pan troglodytes]
GI:4826852 GenBank JAA33844.1 156 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa [Pan troglodytes]
GI:4826852 RefSeq XP_003813759.1 156 PREDICTED: acyl carrier protein, mitochondrial [Pan paniscus]
GI:4826852 RefSeq XP_008955565.1 156 PREDICTED: acyl carrier protein, mitochondrial [Pan paniscus]
GI:4826852 RefSeq XP_009428769.1 156 PREDICTED: acyl carrier protein, mitochondrial isoform X1 [Pan troglodytes]

Related Sequences to LMP001221 proteins

Reference Database Accession Length Protein Name
GI:4826852 GenBank AAC05814.1 161 Acyl carrier protein, Mitochondrial (ACP) (5'partial), partial [Homo sapiens]
GI:4826852 GenBank AAH58920.1 156 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa [Homo sapiens]
GI:4826852 GenBank ABH12222.1 156 mitochondrial complex I subunit NDUFAB1 [Pongo pygmaeus]
GI:4826852 GenBank AIC54799.1 156 NDUFAB1, partial [synthetic construct]
GI:4826852 RefSeq XP_003271372.1 156 PREDICTED: acyl carrier protein, mitochondrial-like [Nomascus leucogenys]
GI:4826852 SwissProt Q0MQC1.1 156 RecName: Full=Acyl carrier protein, mitochondrial; Short=ACP; AltName: Full=NADH-ubiquinone oxidoreductase 9.6 kDa subunit; Flags: Precursor [Pongo pygmaeus]