Gene/Proteome Database (LMPD)
LMPD ID
LMP001278
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
Synonyms
9330109E03Rik; GD3S; Sia-T; Siat8; Siat8a
Alternate Names
alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; SIAT8-A; ST8SiaI; ST8Sia I; GD3 synthase; sialyltransferase 8A; sialyltransferase 8 A; ganglioside GD3 synthase; ganglioside GT3 synthase; sialytransferase St8Sia I; sialyltransferase St8Sia I; alpha-2, 8-sialyltransferase; alpha-2,8-sialyltransferase 8A
Chromosome
6
Map Location
6 G3|6 74.78 cM
EC Number
2.4.99.8
Proteins
| alpha-N-acetylneuraminide alpha-2,8-sialyltransferase | |
|---|---|
| Refseq ID | NP_035504 |
| Protein GI | 70980543 |
| UniProt ID | Q64687 |
| mRNA ID | NM_011374 |
| Length | 355 |
| RefSeq Status | VALIDATED |
| MSPCGRALHTSRGAMAMLARKFPRTRLPVGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLAQRTAWRTNQTSASLFRRQMEDCCDPAHLFAMTKMNSPMGKSLWYDGELLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKMSGCGRQIDEANFVMRCNLPPLSSEYTRDVGSKTQLVTANPSIIRQRFENLLWSRKKFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLKDVGANQTVLFANPNFLRNIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVSIYGFWPFSVNMQGDPISHHYYDNVLPFSGYHAMPEEFLQLWYLHKIGALRMQLDPCEEPSPQPTS | |
Gene Information
Entrez Gene ID
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0003828 | IEA:UniProtKB-EC | F | alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity |
| GO:0034605 | IDA:MGI | P | cellular response to heat |
| GO:0008284 | IDA:MGI | P | positive regulation of cell proliferation |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
| GO:0006665 | IEA:UniProtKB-UniPathway | P | sphingolipid metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu00603 | Glycosphingolipid biosynthesis - globo series |
| mmu01100 | Metabolic pathways |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5893781 | Sialic acid metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Protein Entry
SIA8A_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | CMP-N-acetylneuraminate + alpha-N- acetylneuraminyl-(2->3)-beta-D-galactosyl-R = CMP + alpha-N- acetylneuraminyl-(2->8)-alpha-N-acetylneuraminyl-(2->3)-beta-D- galactosyl-R. {ECO:0000269|PubMed:8910600}. |
| Function | Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid. {ECO:0000269|PubMed:8910600}. |
| Pathway | Lipid metabolism; sphingolipid metabolism. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 29 family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=ST8Sia I; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_656"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001278 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 70980543 | RefSeq | NP_035504 | 355 | alpha-N-acetylneuraminide alpha-2,8-sialyltransferase |
Identical Sequences to LMP001278 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:70980543 | GenBank | AAH24821.1 | 355 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [Mus musculus] |
| GI:70980543 | GenBank | EDL10653.1 | 355 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [Mus musculus] |
| GI:70980543 | SwissProt | Q64687.2 | 355 | RecName: Full=Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; AltName: Full=Alpha-2,8-sialyltransferase 8A; AltName: Full=Ganglioside GD3 synthase; AltName: Full=Ganglioside GT3 synthase; AltName: Full=Sialyltransferase 8A; Short=SIAT8-A; AltName: Full=Sialyltransferase St8Sia I; Short=ST8SiaI [Mus musculus] |
Related Sequences to LMP001278 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:70980543 | DBBJ | BAC32625.1 | 355 | unnamed protein product [Mus musculus] |
| GI:70980543 | DBBJ | BAC34994.1 | 355 | unnamed protein product [Mus musculus] |
| GI:70980543 | EMBL | CAA59014.1 | 355 | GD3 synthase [Mus musculus] |
| GI:70980543 | GenBank | EDM01472.1 | 356 | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [Rattus norvegicus] |
| GI:70980543 | PRF | - | 341 | GD3 synthase [Mus musculus] |
| GI:70980543 | RefSeq | NP_036945.2 | 356 | alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Rattus norvegicus] |