Gene/Proteome Database (LMPD)

LMPD ID
LMP001278
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
Synonyms
9330109E03Rik; GD3S; Sia-T; Siat8; Siat8a
Alternate Names
alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; SIAT8-A; ST8SiaI; ST8Sia I; GD3 synthase; sialyltransferase 8A; sialyltransferase 8 A; ganglioside GD3 synthase; ganglioside GT3 synthase; sialytransferase St8Sia I; sialyltransferase St8Sia I; alpha-2, 8-sialyltransferase; alpha-2,8-sialyltransferase 8A
Chromosome
6
Map Location
6 G3|6 74.78 cM
EC Number
2.4.99.8

Proteins

alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
Refseq ID NP_035504
Protein GI 70980543
UniProt ID Q64687
mRNA ID NM_011374
Length 355
RefSeq Status VALIDATED
MSPCGRALHTSRGAMAMLARKFPRTRLPVGASALCVVVLCWLYIFPVYRLPNEKEIVQGVLAQRTAWRTNQTSASLFRRQMEDCCDPAHLFAMTKMNSPMGKSLWYDGELLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKMSGCGRQIDEANFVMRCNLPPLSSEYTRDVGSKTQLVTANPSIIRQRFENLLWSRKKFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLKDVGANQTVLFANPNFLRNIGKFWKSRGIHAKRLSTGLFLVSAALGLCEEVSIYGFWPFSVNMQGDPISHHYYDNVLPFSGYHAMPEEFLQLWYLHKIGALRMQLDPCEEPSPQPTS

Gene Information

Entrez Gene ID
Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0003828 IEA:UniProtKB-EC F alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity
GO:0034605 IDA:MGI P cellular response to heat
GO:0008284 IDA:MGI P positive regulation of cell proliferation
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation
GO:0006665 IEA:UniProtKB-UniPathway P sphingolipid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00603 Glycosphingolipid biosynthesis - globo series
mmu01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5893781 Sialic acid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Protein Entry
SIA8A_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity CMP-N-acetylneuraminate + alpha-N- acetylneuraminyl-(2->3)-beta-D-galactosyl-R = CMP + alpha-N- acetylneuraminyl-(2->8)-alpha-N-acetylneuraminyl-(2->3)-beta-D- galactosyl-R. {ECO:0000269|PubMed:8910600}.
Function Involved in the production of gangliosides GD3 and GT3 from GM3; gangliosides are a subfamily of complex glycosphinglolipds that contain one or more residues of sialic acid. {ECO:0000269|PubMed:8910600}.
Pathway Lipid metabolism; sphingolipid metabolism.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 29 family. {ECO:0000305}.
Subcellular Location Golgi apparatus membrane {ECO:0000305}; Single-pass type II membrane protein {ECO:0000305}.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=ST8Sia I; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_656";

Identical and Related Proteins

Unique RefSeq proteins for LMP001278 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
70980543 RefSeq NP_035504 355 alpha-N-acetylneuraminide alpha-2,8-sialyltransferase

Identical Sequences to LMP001278 proteins

Reference Database Accession Length Protein Name
GI:70980543 GenBank AAH24821.1 355 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [Mus musculus]
GI:70980543 GenBank EDL10653.1 355 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [Mus musculus]
GI:70980543 SwissProt Q64687.2 355 RecName: Full=Alpha-N-acetylneuraminide alpha-2,8-sialyltransferase; AltName: Full=Alpha-2,8-sialyltransferase 8A; AltName: Full=Ganglioside GD3 synthase; AltName: Full=Ganglioside GT3 synthase; AltName: Full=Sialyltransferase 8A; Short=SIAT8-A; AltName: Full=Sialyltransferase St8Sia I; Short=ST8SiaI [Mus musculus]

Related Sequences to LMP001278 proteins

Reference Database Accession Length Protein Name
GI:70980543 DBBJ BAC32625.1 355 unnamed protein product [Mus musculus]
GI:70980543 DBBJ BAC34994.1 355 unnamed protein product [Mus musculus]
GI:70980543 EMBL CAA59014.1 355 GD3 synthase [Mus musculus]
GI:70980543 GenBank EDM01472.1 356 ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1 [Rattus norvegicus]
GI:70980543 PRF - 341 GD3 synthase [Mus musculus]
GI:70980543 RefSeq NP_036945.2 356 alpha-N-acetylneuraminide alpha-2,8-sialyltransferase [Rattus norvegicus]