Gene/Proteome Database (LMPD)

LMPD ID
LMP001318
Gene ID
1562
Species
Homo sapiens (Human)
Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 18
Gene Symbol
CYP2C18
Synonyms
CPCI; CYP2C; CYP2C17; P450-6B/29C; P450IIC17
Alternate Names
cytochrome P450 2C18; CYPIIC18; cytochrome P450-6B/29C; microsomal monooxygenase; unspecific monooxygenase; flavoprotein-linked monooxygenase; (S)-mephenytoin hydroxylase associated cytochrome P450; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 17; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 18
Chromosome
10
Map Location
10q24
EC Number
1.14.14.1
Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum but its specific substrate has not yet been determined. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. An additional gene, CYP2C17, was once thought to exist; however, CYP2C17 is now considered an artefact based on a chimera of CYP2C18 and CYP2C19. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for CYP2C18

Proteins

cytochrome P450 2C18 isoform 1 precursor
Refseq ID NP_000763
Protein GI 13699816
UniProt ID P33260
mRNA ID NM_000772
Length 490
RefSeq Status REVIEWED
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFKKSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV
cytochrome P450 2C18 isoform 2 precursor
Refseq ID NP_001122397
Protein GI 193083148
UniProt ID P33260
mRNA ID NM_001128925
Length 431
RefSeq Status REVIEWED
MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQEKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFKKSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2723 peptide sequence: MDPAVALVLCLSCLFLLSLWRQSSG sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2723 peptide sequence: MDPAVALVLCLSCLFLLSLWRQSSG

Gene Information

Entrez Gene ID
1562
Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 18
Gene Symbol
CYP2C18
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0070330 IEA:UniProtKB-EC F aromatase activity
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004497 TAS:ProtInc F monooxygenase activity
GO:0019825 TAS:ProtInc F oxygen binding
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0006805 TAS:Reactome P xenobiotic metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa05204 Chemical carcinogenesis
hsa00830 Retinol metabolism
hsa04726 Serotonergic synapse

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 18
Protein Entry
CP2CI_HUMAN
UniProt ID
P33260
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P33260-1; Sequence=Displayed; Name=2; IsoId=P33260-2; Sequence=VSP_042520; Note=No experimental confirmation available.;
Catalytic Activity RH + reduced flavoprotein + O(2) = ROH + oxidized flavoprotein + H(2)O.
Cofactor Name=heme; Xref=ChEBI
Function Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
Induction P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.
Similarity Belongs to the cytochrome P450 family.
Subcellular Location Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP001318 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13699816 RefSeq NP_000763 490 cytochrome P450 2C18 isoform 1 precursor
193083148 RefSeq NP_001122397 431 cytochrome P450 2C18 isoform 2 precursor

Identical Sequences to LMP001318 proteins

Reference Database Accession Length Protein Name
GI:13699816 DBBJ BAG36199.1 490 unnamed protein product [Homo sapiens]
GI:193083148 GenBank AAH96260.1 431 CYP2C18 protein [Homo sapiens]
GI:13699816 GenBank ACP57459.1 490 Sequence 1588 from patent US 7482117
GI:13699816 GenBank ADQ31959.1 490 cytochrome P450, family 2, subfamily C, polypeptide 18, partial [synthetic construct]
GI:13699816 GenBank ADS31056.1 490 Sequence 1588 from patent US 7781168
GI:13699816 GenBank AHE01167.1 490 Sequence 56083 from patent US 8586006
GI:13699816 GenBank AIC48606.1 490 CYP2C18, partial [synthetic construct]

Related Sequences to LMP001318 proteins

Reference Database Accession Length Protein Name
GI:13699816 DBBJ BAD97230.1 490 cytochrome P450, family 2, subfamily C, polypeptide 18 variant, partial [Homo sapiens]
GI:193083148 GenBank AAB59356.1 490 cytochrome [Homo sapiens]
GI:13699816 GenBank AAA02630.1 490 cytochrome P-4502C18 [Homo sapiens]
GI:193083148 GenBank AAE24905.1 490 Sequence 5 from patent US 5912120
GI:13699816 GenBank AAE24908.1 490 Sequence 11 from patent US 5912120
GI:193083148 GenBank AAH69666.1 490 Cytochrome P450, family 2, subfamily C, polypeptide 18 [Homo sapiens]
GI:193083148 GenBank EAW50024.1 490 hCG39167, isoform CRA_b [Homo sapiens]
GI:13699816 GenBank ACM84983.1 495 Sequence 10481 from patent US 6812339
GI:193083148 GenBank ACP57459.1 490 Sequence 1588 from patent US 7482117
GI:193083148 RefSeq NP_000763.1 490 cytochrome P450 2C18 isoform 1 precursor [Homo sapiens]
GI:13699816 RefSeq NP_001180995.1 490 cytochrome P450 2C18 precursor [Macaca mulatta]
GI:13699816 RefSeq XP_004049863.1 490 PREDICTED: cytochrome P450 2C18-like [Gorilla gorilla gorilla]