Gene/Proteome Database (LMPD)

LMPD ID
LMP001319
Gene ID
1557
Species
Homo sapiens (Human)
Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 19
Gene Symbol
CYP2C19
Synonyms
CPCJ; CYP2C; CYPIIC17; CYPIIC19; P450C2C; P450IIC19
Alternate Names
cytochrome P450 2C19; cytochrome P450-11A; cytochrome P450-254C; cytochrome P-450 II C; microsomal monooxygenase; xenobiotic monooxygenase; mephenytoin 4-hydroxylase', "mephenytoin 4'-hydroxylase;,S-mephenytoin 4-hydroxylase; (R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; flavoprotein-linked monooxygenase; cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 19
Chromosome
10
Map Location
10q24
EC Number
1.14.13.-
Summary
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize many xenobiotics, including the anticonvulsive drug mephenytoin, omeprazole, diazepam and some barbiturates. Polymorphism within this gene is associated with variable ability to metabolize mephenytoin, known as the poor metabolizer and extensive metabolizer phenotypes. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for CYP2C19

Proteins

cytochrome P450 2C19 precursor
Refseq ID NP_000760
Protein GI 4503219
UniProt ID P33261
mRNA ID NM_000769
Length 490
RefSeq Status REVIEWED
MDPFVVLVLCLSCLLLLSIWRQSSGRGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV
sig_peptide: 1..25 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2793 peptide sequence: MDPFVVLVLCLSCLLLLSIWRQSSG

Gene Information

Entrez Gene ID
1557
Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 19
Gene Symbol
CYP2C19
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0043231 TAS:ProtInc C intracellular membrane-bounded organelle
GO:0052741 IEA:UniProtKB-EC F (R)-limonene 6-monooxygenase activity
GO:0018675 IEA:UniProtKB-EC F (S)-limonene 6-monooxygenase activity
GO:0018676 IEA:UniProtKB-EC F (S)-limonene 7-monooxygenase activity
GO:0019899 IPI:BHF-UCL F enzyme binding
GO:0020037 IDA:UniProtKB F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004497 IDA:BHF-UCL F monooxygenase activity
GO:0016491 IDA:BHF-UCL F oxidoreductase activity
GO:0019825 TAS:ProtInc F oxygen binding
GO:0008395 IMP:BHF-UCL F steroid hydroxylase activity
GO:0019369 TAS:Reactome P arachidonic acid metabolic process
GO:0017144 IDA:BHF-UCL P drug metabolic process
GO:0019373 TAS:Reactome P epoxygenase P450 pathway
GO:0042738 IDA:BHF-UCL P exogenous drug catabolic process
GO:0046483 IDA:BHF-UCL P heterocycle metabolic process
GO:0016098 IDA:BHF-UCL P monoterpenoid metabolic process
GO:0097267 TAS:Reactome P omega-hydroxylase P450 pathway
GO:0055114 IDA:BHF-UCL P oxidation-reduction process
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0008202 IMP:BHF-UCL P steroid metabolic process
GO:0006805 TAS:Reactome P xenobiotic metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa05204 Chemical carcinogenesis
hsa04726 Serotonergic synapse

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_150417 Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET)

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 2, subfamily C, polypeptide 19
Protein Entry
CP2CJ_HUMAN
UniProt ID
P33261
Species
Human

Comments

Comment Type Description
Catalytic Activity (+)-(R)-limonene + NADPH + O(2) = (+)-trans- carveol + NADP(+) + H(2)O.
Catalytic Activity (-)-(S)-limonene + NADPH + O(2) = (-)-perillyl alcohol + NADP(+) + H(2)O.
Catalytic Activity (-)-(S)-limonene + NADPH + O(2) = (-)-trans- carveol + NADP(+) + H(2)O.
Caution P450-254C was originally listed as a separate gene (CYP2C17). Resequencing demonstrated that it is not a separate gene, but a chimera. The 5'-portion corresponds to a partial 2C18 clone, and the 3'-portion corresponds to a partial 2C19 clone.
Cofactor Name=heme; Xref=ChEBI
Function Responsible for the metabolism of a number of therapeutic agents such as the anticonvulsant drug S-mephenytoin, omeprazole, proguanil, certain barbiturates, diazepam, propranolol, citalopram and imipramine.
Induction P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.
Polymorphism Genetic variation in CYP2C19 is responsible for poor drug metabolism [MIM
Similarity Belongs to the cytochrome P450 family.
Subcellular Location Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Web Resource Name=Cytochrome P450 Allele Nomenclature Committee; Note=CYP2C19 alleles; URL="http://www.cypalleles.ki.se/cyp2c19.htm";
Web Resource Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/cyp2c19/";

Identical and Related Proteins

Unique RefSeq proteins for LMP001319 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4503219 RefSeq NP_000760 490 cytochrome P450 2C19 precursor

Identical Sequences to LMP001319 proteins

Reference Database Accession Length Protein Name
GI:4503219 GenBank AAB59426.1 490 cytochrome [Homo sapiens]
GI:4503219 GenBank AAE24903.1 490 Sequence 1 from patent US 5912120
GI:4503219 GenBank AEP61334.1 490 Sequence 16 from patent US 8026085
GI:4503219 GenBank AFQ85867.1 490 Sequence 16 from patent US 8252559
GI:4503219 GenBank AHE01168.1 490 Sequence 56084 from patent US 8586006

Related Sequences to LMP001319 proteins

Reference Database Accession Length Protein Name
GI:4503219 DBBJ BAG73070.1 490 cytochrome P450, family 2, subfamily C, polypeptide 19, partial [synthetic construct]
GI:4503219 GenBank AAV41877.1 490 cytochrome P450, family 2, subfamily C, polypeptide 19 [Homo sapiens]
GI:4503219 GenBank AAI11847.1 490 CYP2C19 protein, partial [synthetic construct]
GI:4503219 GenBank EAW50022.1 490 hCG1685854 [Homo sapiens]
GI:4503219 RefSeq XP_001152464.1 490 PREDICTED: cytochrome P450 2C19 isoform X2 [Pan troglodytes]
GI:4503219 SwissProt P33261.3 490 RecName: Full=Cytochrome P450 2C19; AltName: Full=(R)-limonene 6-monooxygenase; AltName: Full=(S)-limonene 6-monooxygenase; AltName: Full=(S)-limonene 7-monooxygenase; AltName: Full=CYPIIC17; AltName: Full=CYPIIC19; AltName: Full=Cytochrome P450-11A; AltName: Full=Cytochrome P450-254C; AltName: Full=Mephenytoin 4-hydroxylase [Homo sapiens]