Gene/Proteome Database (LMPD)
LMPD ID
LMP001324
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Gene Symbol
Synonyms
EF; Mom1; Pla2; sPLA2; sPla2-IIA
Alternate Names
phospholipase A2, membrane associated; GIIC sPLA2; enhancing factor; modifier of Min1; group IIA phospholipase A2; phospholipase A2 group IIa; secretory group II phospholipase A2; phosphatidylcholine 2-acylhydrolase 2A; non-pancreatic secreted type II phospholipase A2
Chromosome
4
Map Location
4 D3|4 70.57 cM
EC Number
3.1.1.4
Summary
Proteins belonging to the phospholipase A2 (PLA2) family hydrolyze phospholipids into sn2 fatty acids and lysophospholipids. They function in a variety of cellular processes, including the digestion of phospholipids and the production of molecules that induce inflammatory responses. This gene encodes a member of the group II class of secretory PLA2s. The secreted enzyme binds to heparin on the cell surface. Mutations in this gene increase the occurrence of intestinal polyps caused by a dominant mutation in the adenomatosis polyposis coli gene. A frameshift inactivates this gene product in some mouse strains including the strain of the reference genome, C57BL/6J, whereas a functional protein is produced in other strains. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| phospholipase A2, membrane associated precursor | |
|---|---|
| Refseq ID | NP_001076000 |
| Protein GI | 132626633 |
| UniProt ID | P31482 |
| mRNA ID | NM_001082531 |
| Length | 146 |
| RefSeq Status | REVIEWED |
| MKVLLLLAASIMAFGSIQVQGNIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGKKPKC | |
| sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2191 peptide sequence: MKVLLLLAASIMAFGSIQVQG mat_peptide: 22..146 product: phospholipase A2, membrane associated calculated_mol_wt: 13972 peptide sequence: NIAQFGEMIRLKTGKRAELSYAFYGCHCGLGGKGSPKDATDRCCVTHDCCYKSLEKSGCGTKLLKYKYSHQGGQITCSANQNSCQKRLCQCDKAAAECFARNKKTYSLKYQFYPNMFCKGKKPKC | |
Gene Information
Entrez Gene ID
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0005509 | IEA:InterPro | F | calcium ion binding |
| GO:0004623 | IEA:UniProtKB-EC | F | phospholipase A2 activity |
| GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
| GO:0008285 | IGI:MGI | P | negative regulation of cell proliferation |
| GO:0050680 | IGI:MGI | P | negative regulation of epithelial cell proliferation |
| GO:0006644 | IEA:InterPro | P | phospholipid metabolic process |
| GO:0042127 | IGI:MGI | P | regulation of cell proliferation |
| GO:0050678 | IGI:MGI | P | regulation of epithelial cell proliferation |
| GO:0040008 | IEA:UniProtKB-KW | P | regulation of growth |
| GO:0035019 | IGI:MGI | P | somatic stem cell maintenance |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phospholipase A2, group IIA (platelets, synovial fluid)
Protein Entry
PA2GA_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO:0000255|PROSITE- ProRule:PRU10035, ECO:0000255|PROSITE-ProRule:PRU10036}. |
| Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000250}; Note=Binds 1 Ca(2+) ion per subunit. {ECO:0000250}; |
| Function | May play a role in cell proliferation, by increasing the binding of EGF to the cells and thereby modulating its action. In doing so, this isozyme binds to a membrane-associated receptor distinct from the EGF receptor and which could be a heparan- sulfate proteoglycan located on the cell membrane. |
| Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. |
| Polymorphism | In strains 129/Sv, B10.RIII and C57BL/6, a polymorphism causes a frameshift and premature truncation of the protein, rendering it inactive. Strains BALB/c, C3H/He, DBA/1, DBA/2, MRL and NZB/B1N contain the normal protein while strain CD- 1 is heterozygous for the mutation. |
| Sequence Caution | Sequence=AAB06315.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
| Similarity | Belongs to the phospholipase A2 family. {ECO:0000305}. |
| Subcellular Location | Membrane; Peripheral membrane protein. |
| Tissue Specificity | Mainly in the Paneth cells adjacent to the stem population in the small intestines. Also expressed in regenerating liver and hyperplastic esophageal epithelium. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001324 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 132626633 | RefSeq | NP_001076000 | 146 | phospholipase A2, membrane associated precursor |
Identical Sequences to LMP001324 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:132626633 | GenBank | AAE47930.1 | 146 | Sequence 3 from patent US 6103469 |
| GI:132626633 | GenBank | AAM60043.1 | 146 | Sequence 3 from patent US 6399301 |
| GI:132626633 | GenBank | AAH45156.1 | 146 | Pla2g2a protein [Mus musculus] |
| GI:132626633 | GenBank | AEU43276.1 | 146 | Sequence 25 from patent US 8052970 |
| GI:132626633 | GenBank | AHB62392.1 | 146 | phospholipase A2 group IIa [Mus musculus] |
| GI:132626633 | SwissProt | P31482.3 | 146 | RecName: Full=Phospholipase A2, membrane associated; AltName: Full=Enhancing factor; Short=EF; AltName: Full=GIIC sPLA2; AltName: Full=Group IIA phospholipase A2; AltName: Full=Phosphatidylcholine 2-acylhydrolase 2A; Flags: Precursor [Mus musculus] |
Related Sequences to LMP001324 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:132626633 | EMBL | CAA52325.1 | 146 | enhancing factor [Mus musculus] |
| GI:132626633 | GenBank | AAB06315.1 | 118 | type II phospholipase A2 [Mus musculus] |
| GI:132626633 | GenBank | EGV96853.1 | 146 | Phospholipase A2, membrane associated [Cricetulus griseus] |
| GI:132626633 | GenBank | AHB62391.1 | 132 | phospholipase A2 group IIa, partial [Mus musculus] |
| GI:132626633 | GenBank | AHB62397.1 | 146 | phospholipase A2 group IIa [Mus musculus] |
| GI:132626633 | RefSeq | XP_007645636.1 | 146 | PREDICTED: phospholipase A2, membrane associated isoform X1 [Cricetulus griseus] |