Gene/Proteome Database (LMPD)

LMPD ID
LMP001382
Gene ID
56348
Species
Mus musculus (Mouse)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Gene Symbol
Hsd17b12
Synonyms
2610510O05Rik; AI172963; KIK-I; Kik1
Alternate Names
estradiol 17-beta-dehydrogenase 12; KAR; keratonectin; keratoadhesin; 17-beta-HSD 12; steroid dehydrogenase; 3-ketoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12
Chromosome
2
Map Location
2 E1|2
EC Number
1.1.1.62

Proteins

estradiol 17-beta-dehydrogenase 12
Refseq ID NP_062631
Protein GI 9789991
UniProt ID O70503
mRNA ID NM_019657
Length 312
RefSeq Status PROVISIONAL
MECAPPAAGFLYWVGASTIAYLALRASYSLFRAFQVWCVGNEALVGPRLGEWAVVTGGTDGIGKAYAEELAKRGMKIVLISRSQDKLNQVSNNIKEKFNVETRTIAVDFSLDDIYDKIKTGLSGLEIGVLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSVCKVTRLVLPGMVERSKGVILNISSASGMLPVPLLTIYSATKAFVDFFSQCLHEEYKSKGIFVQSVMPYLVATKLAKIQKPTLDKPSAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKSLRNRYLKKRKKN

Gene Information

Entrez Gene ID
56348
Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Gene Symbol
Hsd17b12
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0031012 IDA:MGI C extracellular matrix
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005518 IDA:MGI F collagen binding
GO:0004303 IEA:UniProtKB-EC F estradiol 17-beta-dehydrogenase activity
GO:0001968 IDA:MGI F fibronectin binding
GO:0008201 IDA:MGI F heparin binding
GO:0006703 IEA:UniProtKB-UniPathway P estrogen biosynthetic process
GO:0030198 IDA:MGI P extracellular matrix organization
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process
GO:0010811 IDA:MGI P positive regulation of cell-substrate adhesion

KEGG Pathway Links

KEGG Pathway ID Description
mmu01040 Biosynthesis of unsaturated fatty acids
mmu00062 Fatty acid elongation
mmu00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Protein Entry
DHB12_MOUSE
UniProt ID
O70503
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O70503-1; Sequence=Displayed; Name=2; IsoId=O70503-2; Sequence=VSP_020255; Note=No experimental confirmation available.;
Catalytic Activity 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H.
Domain The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins. {ECO:0000250}.
Function Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in females. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation (By similarity). {ECO:0000250}.
Pathway Lipid metabolism; fatty acid biosynthesis.
Pathway Steroid biosynthesis; estrogen biosynthesis.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Tissue Specificity Expressed in most tissues tested. {ECO:0000269|PubMed:12482854}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001382 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
9789991 RefSeq NP_062631 312 estradiol 17-beta-dehydrogenase 12

Identical Sequences to LMP001382 proteins

Reference Database Accession Length Protein Name
GI:9789991 DBBJ BAC38354.1 312 unnamed protein product [Mus musculus]
GI:9789991 DBBJ BAC38583.1 312 unnamed protein product [Mus musculus]
GI:9789991 DBBJ BAC40401.1 312 unnamed protein product [Mus musculus]
GI:9789991 DBBJ BAE38530.1 312 unnamed protein product [Mus musculus]
GI:9789991 GenBank AAH90659.1 312 Hydroxysteroid (17-beta) dehydrogenase 12 [Mus musculus]
GI:9789991 GenBank EDL27639.1 312 hydroxysteroid (17-beta) dehydrogenase 12, isoform CRA_b [Mus musculus]

Related Sequences to LMP001382 proteins

Reference Database Accession Length Protein Name
GI:9789991 DBBJ BAE29906.1 312 unnamed protein product [Mus musculus]
GI:9789991 DBBJ BAE39915.1 312 unnamed protein product [Mus musculus]
GI:9789991 DBBJ BAE31260.1 312 unnamed protein product [Mus musculus]
GI:9789991 GenBank EDL79606.1 312 hydroxysteroid (17-beta) dehydrogenase 12, isoform CRA_b [Rattus norvegicus]
GI:9789991 RefSeq XP_006234661.1 312 PREDICTED: estradiol 17-beta-dehydrogenase 12 isoform X1 [Rattus norvegicus]
GI:9789991 SwissProt Q6P7R8.1 312 RecName: Full=Estradiol 17-beta-dehydrogenase 12; AltName: Full=17-beta-hydroxysteroid dehydrogenase 12; Short=17-beta-HSD 12; AltName: Full=3-ketoacyl-CoA reductase; Short=KAR [Rattus norvegicus]