Gene/Proteome Database (LMPD)
LMPD ID
LMP001382
Gene ID
Species
Mus musculus (Mouse)
Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Gene Symbol
Synonyms
2610510O05Rik; AI172963; KIK-I; Kik1
Alternate Names
estradiol 17-beta-dehydrogenase 12; KAR; keratonectin; keratoadhesin; 17-beta-HSD 12; steroid dehydrogenase; 3-ketoacyl-CoA reductase; 17-beta-hydroxysteroid dehydrogenase 12
Chromosome
2
Map Location
2 E1|2
EC Number
1.1.1.62
Proteins
| estradiol 17-beta-dehydrogenase 12 | |
|---|---|
| Refseq ID | NP_062631 |
| Protein GI | 9789991 |
| UniProt ID | O70503 |
| mRNA ID | NM_019657 |
| Length | 312 |
| RefSeq Status | PROVISIONAL |
| MECAPPAAGFLYWVGASTIAYLALRASYSLFRAFQVWCVGNEALVGPRLGEWAVVTGGTDGIGKAYAEELAKRGMKIVLISRSQDKLNQVSNNIKEKFNVETRTIAVDFSLDDIYDKIKTGLSGLEIGVLVNNVGMSYEYPEYFLEIPDLDNTIKKLININVLSVCKVTRLVLPGMVERSKGVILNISSASGMLPVPLLTIYSATKAFVDFFSQCLHEEYKSKGIFVQSVMPYLVATKLAKIQKPTLDKPSAETFVKSAIKTVGLQTRTTGYVIHSLMGSINSIMPRWMYFKIIMGFSKSLRNRYLKKRKKN | |
Gene Information
Entrez Gene ID
Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0031012 | IDA:MGI | C | extracellular matrix |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005518 | IDA:MGI | F | collagen binding |
| GO:0004303 | IEA:UniProtKB-EC | F | estradiol 17-beta-dehydrogenase activity |
| GO:0001968 | IDA:MGI | F | fibronectin binding |
| GO:0008201 | IDA:MGI | F | heparin binding |
| GO:0006703 | IEA:UniProtKB-UniPathway | P | estrogen biosynthetic process |
| GO:0030198 | IDA:MGI | P | extracellular matrix organization |
| GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
| GO:0010811 | IDA:MGI | P | positive regulation of cell-substrate adhesion |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
hydroxysteroid (17-beta) dehydrogenase 12
Protein Entry
DHB12_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O70503-1; Sequence=Displayed; Name=2; IsoId=O70503-2; Sequence=VSP_020255; Note=No experimental confirmation available.; |
| Catalytic Activity | 17-beta-estradiol + NAD(P)(+) = estrone + NAD(P)H. |
| Domain | The di-lysine motif confers endoplasmic reticulum localization for type I membrane proteins. {ECO:0000250}. |
| Function | Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in females. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation (By similarity). {ECO:0000250}. |
| Pathway | Lipid metabolism; fatty acid biosynthesis. |
| Pathway | Steroid biosynthesis; estrogen biosynthesis. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 17-beta-HSD 3 subfamily. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Tissue Specificity | Expressed in most tissues tested. {ECO:0000269|PubMed:12482854}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001382 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 9789991 | RefSeq | NP_062631 | 312 | estradiol 17-beta-dehydrogenase 12 |
Identical Sequences to LMP001382 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:9789991 | DBBJ | BAC38354.1 | 312 | unnamed protein product [Mus musculus] |
| GI:9789991 | DBBJ | BAC38583.1 | 312 | unnamed protein product [Mus musculus] |
| GI:9789991 | DBBJ | BAC40401.1 | 312 | unnamed protein product [Mus musculus] |
| GI:9789991 | DBBJ | BAE38530.1 | 312 | unnamed protein product [Mus musculus] |
| GI:9789991 | GenBank | AAH90659.1 | 312 | Hydroxysteroid (17-beta) dehydrogenase 12 [Mus musculus] |
| GI:9789991 | GenBank | EDL27639.1 | 312 | hydroxysteroid (17-beta) dehydrogenase 12, isoform CRA_b [Mus musculus] |
Related Sequences to LMP001382 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:9789991 | DBBJ | BAE29906.1 | 312 | unnamed protein product [Mus musculus] |
| GI:9789991 | DBBJ | BAE39915.1 | 312 | unnamed protein product [Mus musculus] |
| GI:9789991 | DBBJ | BAE31260.1 | 312 | unnamed protein product [Mus musculus] |
| GI:9789991 | GenBank | EDL79606.1 | 312 | hydroxysteroid (17-beta) dehydrogenase 12, isoform CRA_b [Rattus norvegicus] |
| GI:9789991 | RefSeq | XP_006234661.1 | 312 | PREDICTED: estradiol 17-beta-dehydrogenase 12 isoform X1 [Rattus norvegicus] |
| GI:9789991 | SwissProt | Q6P7R8.1 | 312 | RecName: Full=Estradiol 17-beta-dehydrogenase 12; AltName: Full=17-beta-hydroxysteroid dehydrogenase 12; Short=17-beta-HSD 12; AltName: Full=3-ketoacyl-CoA reductase; Short=KAR [Rattus norvegicus] |