Gene/Proteome Database (LMPD)

LMPD ID
LMP001388
Gene ID
20493
Species
Mus musculus (Mouse)
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter family), member 1
Gene Symbol
Slc10a1
Synonyms
Ntcp
Alternate Names
sodium/bile acid cotransporter; Na(+)/bile acid cotransporter; Na(+)/taurocholate transport protein; bile acid cotransporting polypeptide; sodium bile acid cotransporting polypeptide; sodium-taurocholate cotransporting polypeptide; sodium/taurocholate cotransporting polypeptide
Chromosome
12
Map Location
12 D1|12 37.21 cM

Proteins

sodium/bile acid cotransporter isoform 1
Refseq ID NP_001171032
Protein GI 294774569
UniProt ID O08705
mRNA ID NM_001177561
Length 362
RefSeq Status VALIDATED
MEAHNVSAPFNFSLPPGFGHRATDTALSVILVVMLLLIMLSLGCTMEFSKIKAHFWKPKGVIIAIVAQYGIMPLSAFLLGKVFHLTSIEALAILICGCSPGGNLSNLFTLAMKGDMNLSIVMTTCSSFTALGMMPLLLYIYSKGIYDGDLKDKVPYKGIMLSLVMVLIPCAIGIFLKSKRPHYVPYVLKAGMIITFSLSVAVTVLSVINVGNSIMFVMTPHLLATSSLMPFTGFLMGYILSALFRLNPSCRRTISMETGFQNVQLCSTILNVTFPPEVIGPLFFFPLLYMIFQLAEGLLFIIIFRCYLKIKPQKDQTKITYKAAATEDATPAALEKGTHNGNNPPTQPGLSPNGLNSGQMAN
sodium/bile acid cotransporter isoform 2
Refseq ID NP_035517
Protein GI 6755528
UniProt ID O35940
mRNA ID NM_011387
Length 317
RefSeq Status VALIDATED
MEAHNVSAPFNFSLPPGFGHRATDTALSVILVVMLLLIMLSLGCTMEFSKIKAHFWKPKGVIIAIVAQYGIMPLSAFLLGKVFHLTSIEALAILICGCSPGGNLSNLFTLAMKGDMNLSIVMTTCSSFTALGMMPLLLYIYSKGIYDGDLKDKVPYKGIMLSLVMVLIPCAIGIFLKSKRPHYVPYVLKAGMIITFSLSVAVTVLSVINVGNSIMFVMTPHLLATSSLMPFTGFLMGYILSALFRLNPSCRRTISMETGFQNVQLCSTILNVTFPPEVIGPLFFFPLLYMIFQLAEGLLFIIIFRCYLKIKPQKGKY

Gene Information

Entrez Gene ID
20493
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter family), member 1
Gene Symbol
Slc10a1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016323 IEA:Ensembl C basolateral plasma membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 IDA:MGI C membrane
GO:0008508 IEA:InterPro F bile acid:sodium symporter activity

KEGG Pathway Links

KEGG Pathway ID Description
ko04976 Bile secretion
mmu04976 Bile secretion

REACTOME Pathway Links

REACTOME Pathway ID Description
5893230 Bile acid and bile salt metabolism
5893229 Recycling of bile acids and salts

Domain Information

InterPro Annotations

Accession Description
IPR004710 Bile acid:sodium symporter
IPR002657 Bile acid:sodium symporter/arsenical resistance protein Acr3

UniProt Annotations

Entry Information

Gene Name
solute carrier family 10 (sodium/bile acid cotransporter family), member 1
Protein Entry
O35940_MOUSE
UniProt ID
O35940
Species
Mouse

Comments

Comment Type Description
Function The hepatic sodium/bile acid uptake system exhibits broad substrate specificity and transports various non-bile acid organic compounds as well. It is strictly dependent on the extracellular presence of sodium.
Similarity Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family. {ECO:0000305}.
Subcellular Location Membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP001388 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
294774569 RefSeq NP_001171032 362 sodium/bile acid cotransporter isoform 1
6755528 RefSeq NP_035517 317 sodium/bile acid cotransporter isoform 2

Identical Sequences to LMP001388 proteins

Reference Database Accession Length Protein Name
GI:294774569 GenBank AAB81023.1 362 Na/taurocholate cotransporting polypeptide 1 [Mus musculus]
GI:6755528 GenBank AAB81024.1 317 Na/taurocholate cotransporting polypeptide 2 [Mus musculus]
GI:294774569 GenBank AAH21154.1 362 Slc10a1 protein [Mus musculus]
GI:294774569 GenBank AAH94023.1 362 Slc10a1 protein [Mus musculus]
GI:294774569 GenBank EDL02695.1 362 solute carrier family 10 (sodium/bile acid cotransporter family), member 1, isoform CRA_a [Mus musculus]
GI:6755528 GenBank EDL02698.1 317 solute carrier family 10 (sodium/bile acid cotransporter family), member 1, isoform CRA_d [Mus musculus]
GI:294774569 RefSeq XP_006515696.1 362 PREDICTED: sodium/bile acid cotransporter isoform X1 [Mus musculus]
GI:294774569 SwissProt O08705.1 362 RecName: Full=Sodium/bile acid cotransporter; AltName: Full=Na(+)/bile acid cotransporter; AltName: Full=Na(+)/taurocholate transport protein; AltName: Full=Sodium/taurocholate cotransporting polypeptide; AltName: Full=Solute carrier family 10 member 1 [Mus musculus]

Related Sequences to LMP001388 proteins

Reference Database Accession Length Protein Name
GI:6755528 DBBJ BAA19846.1 362 sodium-dependent bile acid transporter [Mus musculus]
GI:294774569 GenBank AAA42112.1 362 sodium/bile acid cotransporter [Rattus norvegicus]
GI:6755528 GenBank AAH21154.1 362 Slc10a1 protein [Mus musculus]
GI:294774569 GenBank AAH91152.1 362 Solute carrier family 10 (sodium/bile acid cotransporter family), member 1 [Rattus norvegicus]
GI:6755528 GenBank AAH94023.1 362 Slc10a1 protein [Mus musculus]
GI:6755528 GenBank EDL02695.1 362 solute carrier family 10 (sodium/bile acid cotransporter family), member 1, isoform CRA_a [Mus musculus]
GI:294774569 GenBank EDL81408.1 362 solute carrier family 10 (sodium/bile acid cotransporter family), member 1, isoform CRA_b [Rattus norvegicus]
GI:294774569 GenBank AEK13627.1 362 Sequence 39 from patent US 7972785
GI:294774569 RefSeq NP_058743.1 362 sodium/bile acid cotransporter [Rattus norvegicus]
GI:6755528 RefSeq NP_001171032.1 362 sodium/bile acid cotransporter isoform 1 [Mus musculus]
GI:294774569 SwissProt P26435.1 362 RecName: Full=Sodium/bile acid cotransporter; AltName: Full=Na(+)/bile acid cotransporter; AltName: Full=Na(+)/taurocholate transport protein; AltName: Full=Sodium/taurocholate cotransporting polypeptide; AltName: Full=Solute carrier family 10 member 1 [Rattus norvegicus]
GI:6755528 SwissProt O08705.1 362 RecName: Full=Sodium/bile acid cotransporter; AltName: Full=Na(+)/bile acid cotransporter; AltName: Full=Na(+)/taurocholate transport protein; AltName: Full=Sodium/taurocholate cotransporting polypeptide; AltName: Full=Solute carrier family 10 member 1 [Mus musculus]