Gene/Proteome Database (LMPD)

LMPD ID
LMP001486
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidylserine synthase 2
Gene Symbol
Synonyms
PSS2
Alternate Names
phosphatidylserine synthase 2; PSS-2; ptdSer synthase 2; serine-exchange enzyme II
Chromosome
11
Map Location
11p15.5
EC Number
2.7.8.29
Summary
Phosphatidylserine (PS) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, PS is involved in cell signaling, blood coagulation, and apoptosis. PS is synthesized by a calcium-dependent base-exchange reaction catalyzed by PS synthases (EC 2.7.8.8), like PTDSS2, that exchange L-serine for the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) (Sturbois-Balcerzak et al., 2001 [PubMed 11084049]).[supplied by OMIM, May 2009]
Orthologs

Proteins

phosphatidylserine synthase 2
Refseq ID NP_110410
Protein GI 13540555
UniProt ID Q9BVG9
mRNA ID NM_030783
Length 487
RefSeq Status PROVISIONAL
MRRGERRDAGGPRPESPVPAGRASLEEPPDGPSAGQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFILFQTVQDGRQFLKYVDPKLGVPLPERDYGGNCLIYDPDNETDPFHNIWDKLDGFVPAHFLGWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLVCNGLGIYCGMKTLEWLSLKTYKWQGLWNIPTYKGKMKRIAFQFTPYSWVRFEWKPASSLRRWLAVCGIILVFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDDPKPHKKLGPQAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGSVLALTWTVWRFFLRDITLRYKETRWQKWQNKDDQGSTVGNGDQHPLGLDEDLLGPGVAEGEGAPTPN

Gene Information

Entrez Gene ID
Gene Name
phosphatidylserine synthase 2
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 ISS:UniProtKB C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 ISS:UniProtKB C membrane
GO:0003882 IEA:Ensembl F CDP-diacylglycerol-serine O-phosphatidyltransferase activity
GO:0046474 TAS:Reactome P glycerophospholipid biosynthetic process
GO:0006659 TAS:Reactome P phosphatidylserine biosynthetic process
GO:0006644 TAS:Reactome P phospholipid metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00564 Glycerophospholipid metabolism
hsa01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_121401 Glycerophospholipid biosynthesis
REACT_120823 Synthesis of PS

Domain Information

InterPro Annotations

Accession Description
IPR004277 Phosphatidyl serine synthase

UniProt Annotations

Entry Information

Gene Name
phosphatidylserine synthase 2
Protein Entry
PTSS2_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=120 uM for serine (in the presence of 1 mM PE) ; Vmax=0.57 mmol/h/mg enzyme ; pH dependence: Optimum pH is around 7.5. ;
Catalytic Activity L-1-phosphatidylethanolamine + L-serine = L-1- phosphatidylserine + ethanolamine.
Enzyme Regulation Inhibited in both the MAM and the ER per se by ethanolamine. Requires calcium ions.
Function Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. PTDSS2 is specific for phosphatatidylethanolamine and does not act on phosphatidylcholine.
Pathway Phospholipid metabolism; phosphatidylserine biosynthesis.
Similarity Belongs to the phosphatidyl serine synthase family.
Subcellular Location Endoplasmic reticulum membrane {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP001486 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13540555 RefSeq NP_110410 487 phosphatidylserine synthase 2

Identical Sequences to LMP001486 proteins

Reference Database Accession Length Protein Name
GI:13540555 GenBank EAX02327.1 487 phosphatidylserine synthase 2, isoform CRA_a [Homo sapiens]
GI:13540555 GenBank EAX02328.1 487 phosphatidylserine synthase 2, isoform CRA_a [Homo sapiens]
GI:13540555 GenBank EAX02329.1 487 phosphatidylserine synthase 2, isoform CRA_a [Homo sapiens]
GI:13540555 GenBank ABM82669.1 487 phosphatidylserine synthase 2 [synthetic construct]
GI:13540555 GenBank ABM85848.1 487 phosphatidylserine synthase 2, partial [synthetic construct]
GI:13540555 GenBank ACQ18705.1 487 Sequence 619 from patent US 7510850

Related Sequences to LMP001486 proteins

Reference Database Accession Length Protein Name
GI:13540555 GenBank JAA01896.1 487 phosphatidylserine synthase 2 [Pan troglodytes]
GI:13540555 GenBank JAA12199.1 487 phosphatidylserine synthase 2 [Pan troglodytes]
GI:13540555 GenBank JAA25008.1 487 phosphatidylserine synthase 2 [Pan troglodytes]
GI:13540555 GenBank JAA34383.1 487 phosphatidylserine synthase 2 [Pan troglodytes]
GI:13540555 RefSeq XP_003806046.1 487 PREDICTED: phosphatidylserine synthase 2 isoform X2 [Pan paniscus]
GI:13540555 RefSeq XP_004050394.1 487 PREDICTED: phosphatidylserine synthase 2 [Gorilla gorilla gorilla]