Gene/Proteome Database (LMPD)
LMPD ID
LMP001486
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidylserine synthase 2
Gene Symbol
Synonyms
PSS2
Alternate Names
phosphatidylserine synthase 2; PSS-2; ptdSer synthase 2; serine-exchange enzyme II
Chromosome
11
Map Location
11p15.5
EC Number
2.7.8.29
Summary
Phosphatidylserine (PS) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, PS is involved in cell signaling, blood coagulation, and apoptosis. PS is synthesized by a calcium-dependent base-exchange reaction catalyzed by PS synthases (EC 2.7.8.8), like PTDSS2, that exchange L-serine for the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) (Sturbois-Balcerzak et al., 2001 [PubMed 11084049]).[supplied by OMIM, May 2009]
Orthologs
Proteins
| phosphatidylserine synthase 2 | |
|---|---|
| Refseq ID | NP_110410 |
| Protein GI | 13540555 |
| UniProt ID | Q9BVG9 |
| mRNA ID | NM_030783 |
| Length | 487 |
| RefSeq Status | PROVISIONAL |
| MRRGERRDAGGPRPESPVPAGRASLEEPPDGPSAGQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEETPQDTAYNTKRGIVASILVFLCFGVTQAKDGPFSRPHPAYWRFWLCVSVVYELFLIFILFQTVQDGRQFLKYVDPKLGVPLPERDYGGNCLIYDPDNETDPFHNIWDKLDGFVPAHFLGWYLKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSECWWDHWIMDVLVCNGLGIYCGMKTLEWLSLKTYKWQGLWNIPTYKGKMKRIAFQFTPYSWVRFEWKPASSLRRWLAVCGIILVFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGVAMREIYDFMDDPKPHKKLGPQAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGSVLALTWTVWRFFLRDITLRYKETRWQKWQNKDDQGSTVGNGDQHPLGLDEDLLGPGVAEGEGAPTPN | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylserine synthase 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | ISS:UniProtKB | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | ISS:UniProtKB | C | membrane |
| GO:0003882 | IEA:Ensembl | F | CDP-diacylglycerol-serine O-phosphatidyltransferase activity |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0006659 | TAS:Reactome | P | phosphatidylserine biosynthetic process |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121401 | Glycerophospholipid biosynthesis |
| REACT_120823 | Synthesis of PS |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004277 | Phosphatidyl serine synthase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=120 uM for serine (in the presence of 1 mM PE) ; Vmax=0.57 mmol/h/mg enzyme ; pH dependence: Optimum pH is around 7.5. ; |
| Catalytic Activity | L-1-phosphatidylethanolamine + L-serine = L-1- phosphatidylserine + ethanolamine. |
| Enzyme Regulation | Inhibited in both the MAM and the ER per se by ethanolamine. Requires calcium ions. |
| Function | Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. PTDSS2 is specific for phosphatatidylethanolamine and does not act on phosphatidylcholine. |
| Pathway | Phospholipid metabolism; phosphatidylserine biosynthesis. |
| Similarity | Belongs to the phosphatidyl serine synthase family. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP001486 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13540555 | RefSeq | NP_110410 | 487 | phosphatidylserine synthase 2 |
Identical Sequences to LMP001486 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13540555 | GenBank | EAX02327.1 | 487 | phosphatidylserine synthase 2, isoform CRA_a [Homo sapiens] |
| GI:13540555 | GenBank | EAX02328.1 | 487 | phosphatidylserine synthase 2, isoform CRA_a [Homo sapiens] |
| GI:13540555 | GenBank | EAX02329.1 | 487 | phosphatidylserine synthase 2, isoform CRA_a [Homo sapiens] |
| GI:13540555 | GenBank | ABM82669.1 | 487 | phosphatidylserine synthase 2 [synthetic construct] |
| GI:13540555 | GenBank | ABM85848.1 | 487 | phosphatidylserine synthase 2, partial [synthetic construct] |
| GI:13540555 | GenBank | ACQ18705.1 | 487 | Sequence 619 from patent US 7510850 |
Related Sequences to LMP001486 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13540555 | GenBank | JAA01896.1 | 487 | phosphatidylserine synthase 2 [Pan troglodytes] |
| GI:13540555 | GenBank | JAA12199.1 | 487 | phosphatidylserine synthase 2 [Pan troglodytes] |
| GI:13540555 | GenBank | JAA25008.1 | 487 | phosphatidylserine synthase 2 [Pan troglodytes] |
| GI:13540555 | GenBank | JAA34383.1 | 487 | phosphatidylserine synthase 2 [Pan troglodytes] |
| GI:13540555 | RefSeq | XP_003806046.1 | 487 | PREDICTED: phosphatidylserine synthase 2 isoform X2 [Pan paniscus] |
| GI:13540555 | RefSeq | XP_004050394.1 | 487 | PREDICTED: phosphatidylserine synthase 2 [Gorilla gorilla gorilla] |