Gene/Proteome Database (LMPD)

LMPD ID
LMP001494
Gene ID
22318
Species
Mus musculus (Mouse)
Gene Name
vesicle-associated membrane protein 2
Gene Symbol
Vamp2
Synonyms
Syb-2; Syb2; sybII
Alternate Names
vesicle-associated membrane protein 2; VAMP-2; synaptobrevin-2; synaptobrevin II; vesicle-associated membrane 2
Chromosome
11
Map Location
11 B3|11

Proteins

vesicle-associated membrane protein 2
Refseq ID NP_033523
Protein GI 6678551
UniProt ID P63044
mRNA ID NM_009497
Length 116
RefSeq Status PROVISIONAL
MSATAATVPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Gene Information

Entrez Gene ID
22318
Gene Name
vesicle-associated membrane protein 2
Gene Symbol
Vamp2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031201 ISS:UniProtKB C SNARE complex
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0031410 IDA:MGI C cytoplasmic vesicle
GO:0030659 TAS:Reactome C cytoplasmic vesicle membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016020 ISO:MGI C membrane
GO:0043005 IEA:UniProtKB-KW C neuron projection
GO:0048471 IDA:UniProtKB C perinuclear region of cytoplasm
GO:0005886 IDA:MGI C plasma membrane
GO:0030141 IDA:MGI C secretory granule
GO:0030667 TAS:Reactome C secretory granule membrane
GO:0045202 IDA:MGI C synapse
GO:0008021 IDA:MGI C synaptic vesicle
GO:0030672 IDA:MGI C synaptic vesicle membrane
GO:0070044 IDA:MGI C synaptobrevin 2-SNAP-25-syntaxin-1a complex
GO:0070032 ISO:MGI C synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex
GO:0070033 IEA:Ensembl C synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex
GO:0005802 IDA:UniProtKB C trans-Golgi network
GO:0042589 IDA:MGI C zymogen granule membrane
GO:0000149 IDA:MGI F SNARE binding
GO:0048306 ISS:ParkinsonsUK-UCL F calcium-dependent protein binding
GO:0005516 IDA:MGI F calmodulin binding
GO:0005543 IDA:MGI F phospholipid binding
GO:0019905 IPI:UniProtKB F syntaxin binding
GO:0017075 ISO:MGI F syntaxin-1 binding
GO:0043001 IMP:MGI P Golgi to plasma membrane protein transport
GO:0017156 IDA:MGI P calcium ion-dependent exocytosis
GO:0032869 IDA:MGI P cellular response to insulin stimulus
GO:0060291 IMP:MGI P long-term synaptic potentiation
GO:0061025 IMP:MGI P membrane fusion
GO:0090316 IMP:MGI P positive regulation of intracellular protein transport
GO:0006461 IEA:Ensembl P protein complex assembly
GO:0017158 TAS:ParkinsonsUK-UCL P regulation of calcium ion-dependent exocytosis
GO:0017157 IDA:MGI P regulation of exocytosis
GO:0060627 IMP:MGI P regulation of vesicle-mediated transport
GO:0009749 IEA:Ensembl P response to glucose
GO:0016079 IMP:MGI P synaptic vesicle exocytosis

KEGG Pathway Links

KEGG Pathway ID Description
mmu04911 Insulin secretion
mmu04970 Salivary secretion
mmu04721 Synaptic vesicle cycle
mmu04962 Vasopressin-regulated water reabsorption

Domain Information

InterPro Annotations

Accession Description
IPR001388 Synaptobrevin
IPR016444 Synaptobrevin/Vesicle-associated membrane protein

UniProt Annotations

Entry Information

Gene Name
vesicle-associated membrane protein 2
Protein Entry
VAMP2_MOUSE
UniProt ID
P63044
Species
Mouse

Comments

Comment Type Description
Function Involved in the targeting and/or fusion of transport vesicles to their target membrane. {ECO:0000269|PubMed:9430681}.
Interaction P60766:Cdc42; NbExp=2; IntAct=EBI-521920, EBI-81763; P60879:Snap25; NbExp=5; IntAct=EBI-521920, EBI-445270;
Similarity Belongs to the synaptobrevin family. {ECO:0000305}.
Similarity Contains 1 v-SNARE coiled-coil homology domain. {ECO:0000255|PROSITE-ProRule:PRU00290}.
Subcellular Location Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass type IV membrane protein. Cell junction, synapse, synaptosome. Note=Neuronal synaptic vesicles.
Subunit Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A. This complex binds to CPLX1. Interacts with VAPA and VAPB (By similarity). Interacts with BVES and STX4. {ECO:0000250, ECO:0000269|PubMed:17548353, ECO:0000269|PubMed:20057356}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001494 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6678551 RefSeq NP_033523 116 vesicle-associated membrane protein 2

Identical Sequences to LMP001494 proteins

Reference Database Accession Length Protein Name
GI:6678551 GenBank AFD38428.1 116 Sequence 38 from patent US 8124357
GI:6678551 GenBank AFD38430.1 116 Sequence 40 from patent US 8124357
GI:6678551 RefSeq XP_004594820.1 116 PREDICTED: vesicle-associated membrane protein 2 [Ochotona princeps]
GI:6678551 RefSeq XP_005067632.1 116 PREDICTED: vesicle-associated membrane protein 2 [Mesocricetus auratus]
GI:6678551 RefSeq XP_005349860.1 116 PREDICTED: vesicle-associated membrane protein 2 [Microtus ochrogaster]
GI:6678551 RefSeq XP_008853980.1 116 PREDICTED: vesicle-associated membrane protein 2 [Nannospalax galili]

Related Sequences to LMP001494 proteins

Reference Database Accession Length Protein Name
GI:6678551 EMBL CAD61610.1 116 unnamed protein product [Homo sapiens]
GI:6678551 GenBank EAW90087.1 116 vesicle-associated membrane protein 2 (synaptobrevin 2), isoform CRA_b [Homo sapiens]
GI:6678551 GenBank AEP57091.1 116 Sequence 31 from patent US 8022172
GI:6678551 GenBank AEP57092.1 116 Sequence 32 from patent US 8022172
GI:6678551 PDB 2KOG 119 Chain A, Lipid-Bound Synaptobrevin Solution Nmr Structure
GI:6678551 RefSeq XP_001156324.1 116 PREDICTED: vesicle-associated membrane protein 2 isoform X2 [Pan troglodytes]