Gene/Proteome Database (LMPD)
LMPD ID
LMP001504
Gene ID
Species
Homo sapiens (Human)
Gene Name
acyl-CoA synthetase long-chain family member 5
Gene Symbol
Synonyms
ACS2; ACS5; FACL5
Alternate Names
long-chain-fatty-acid--CoA ligase 5; LACS 5; fatty acid coenzyme A ligase 5; long-chain acyl-CoA synthetase 5; FACL5 for fatty acid coenzyme A ligase 5; long-chain fatty acid coenzyme A ligase 5; fatty-acid-Coenzyme A ligase, long-chain 5
Chromosome
10
Map Location
10q25.1-q25.2
EC Number
6.2.1.3
Summary
The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
long-chain-fatty-acid--CoA ligase 5 isoform a | |
---|---|
Refseq ID | NP_057318 |
Protein GI | 42794756 |
UniProt ID | Q9ULC5 |
mRNA ID | NM_016234 |
Length | 739 |
RefSeq Status | REVIEWED |
MDALKPPCLWRNHERGKKDRDSCGRKNSEPGSPHSLEALRDAAPSQGLNFLLLFTKMLFIFNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYEPTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD |
long-chain-fatty-acid--CoA ligase 5 isoform b | |
---|---|
Refseq ID | NP_976313 |
Protein GI | 42794758 |
UniProt ID | Q9ULC5 |
mRNA ID | NM_203379 |
Length | 683 |
RefSeq Status | REVIEWED |
MLFIFNFLFSPLPTPALICILTFGAAIFLWLITRPQPVLPLLDLNNQSVGIEGGARKGVSQKNNDLTSCCFSDAKTMYEVFQRGLAVSDNGPCLGYRKPNQPYRWLSYKQVSDRAEYLGSCLLHKGYKSSPDQFVGIFAQNRPEWIISELACYTYSMVAVPLYDTLGPEAIVHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPKGAMITHQNIVSNAAAFLKCVEHAYEPTPDDVAISYLPLAHMFERIVQAVVYSCGARVGFFQGDIRLLADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLAVSSKFKELQKGIIRHDSFWDKLIFAKIQDSLGGRVRVIVTGAAPMSTSVMTFFRAAMGCQVYEAYGQTECTGGCTFTLPGDWTSGHVGVPLACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDGWLHTGDIGRWLPNGTLKIIDRKKNIFKLAQGEYIAPEKIENIYNRSQPVLQIFVHGESLRSSLVGVVVPDTDVLPSFAAKLGVKGSFEELCQNQVVREAILEDLQKIGKESGLKTFEQVKAIFLHPEPFSIENGLLTPTLKAKRGELSKYFRTQIDSLYEHIQD |
Gene Information
Entrez Gene ID
Gene Name
acyl-CoA synthetase long-chain family member 5
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016020 | IDA:UniProtKB | C | membrane |
GO:0005743 | IEA:Ensembl | C | mitochondrial inner membrane |
GO:0005741 | IEA:UniProtKB-KW | C | mitochondrial outer membrane |
GO:0005739 | IDA:HPA | C | mitochondrion |
GO:0005730 | IDA:HPA | C | nucleolus |
GO:0005634 | IDA:HPA | C | nucleus |
GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
GO:0004467 | IDA:UniProtKB | F | long-chain fatty acid-CoA ligase activity |
GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
GO:0001676 | IDA:UniProtKB | P | long-chain fatty acid metabolic process |
GO:0035338 | TAS:Reactome | P | long-chain fatty-acyl-CoA biosynthetic process |
GO:2001236 | IDA:UniProtKB | P | regulation of extrinsic apoptotic signaling pathway |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
GO:0019432 | TAS:Reactome | P | triglyceride biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa04920 | Adipocytokine signaling pathway |
hsa04146 | Peroxisome |
hsa03320 | PPAR signaling pathway |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY66-387 | fatty acid alpha-oxidation II |
Domain Information
UniProt Annotations
Entry Information
Gene Name
acyl-CoA synthetase long-chain family member 5
Protein Entry
ACSL5_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=ACSL5b, ACSL5-fl; IsoId=Q9ULC5-1; Sequence=Displayed; Note=Localize in mitochondrion and endoplasmic reticulum.; Name=2; Synonyms=ACSL5a; IsoId=Q9ULC5-3; Sequence=VSP_037947; Note=Contains a phosphoserine at position 32.; Name=3; Synonyms=ACSL5delta20; IsoId=Q9ULC5-4; Sequence=VSP_038233; Note=Localize in mitochondrion and endoplasmic reticulum.; |
Biophysicochemical Properties | Kinetic parameters: KM=0.11 uM for palmitic acid (isoform 1 at pH 7.5) ; KM=0.38 uM for palmitic acid (isoform 1 at pH 9.5) ; KM=0.04 uM for palmitic acid (isoform 3 at pH 7.5) ; KM=0.15 uM for palmitic acid (isoform 3 at pH 8.5) ; pH dependence: Optimum pH is 9.5 (isoform 1), 7.5-8.5 (isoform 3). ; |
Catalytic Activity | ATP + a long-chain fatty acid + CoA = AMP + diphosphate + an acyl-CoA. |
Cofactor | Name=Mg(2+); Xref=ChEBI |
Function | Acyl-CoA synthetases (ACSL) activate long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL5 may activate fatty acids from exogenous sources for the synthesis of triacylglycerol destined for intracellular storage (By similarity). Utilizes a wide range of saturated fatty acids with a preference for C16-C18 unsaturated fatty acids (By similarity). It was suggested that it may also stimulate fatty acid oxidation (By similarity). At the villus tip of the crypt-villus axis of the small intestine may sensitize epithelial cells to apoptosis specifically triggered by the death ligand TRAIL. May have a role in the survival of glioma cells. {ECO |
Sequence Caution | Sequence=BAA85979.1; Type=Erroneous initiation; Evidence= ; Sequence=BAA86054.1; Type=Erroneous gene model prediction; Evidence= ; |
Similarity | Belongs to the ATP-dependent AMP-binding enzyme family. |
Subcellular Location | Mitochondrion. Endoplasmic reticulum. Mitochondrion outer membrane ; Single-pass type III membrane protein . Endoplasmic reticulum membrane ; Single-pass type III membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP001504 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
42794756 | RefSeq | NP_057318 | 739 | long-chain-fatty-acid--CoA ligase 5 isoform a |
42794758 | RefSeq | NP_976313 | 683 | long-chain-fatty-acid--CoA ligase 5 isoform b |
Identical Sequences to LMP001504 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:42794758 | GenBank | ABM84192.1 | 683 | acyl-CoA synthetase long-chain family member 5 [synthetic construct] |
GI:42794758 | GenBank | ABM87595.1 | 683 | acyl-CoA synthetase long-chain family member 5, partial [synthetic construct] |
GI:42794758 | GenBank | ACE21989.1 | 683 | Sequence 7220 from patent US 7368531 |
GI:42794758 | GenBank | ACH32740.1 | 683 | Sequence 7220 from patent US 7411051 |
GI:42794756 | GenBank | ADC16209.1 | 739 | Sequence 478 from patent US 7635478 |
GI:42794756 | GenBank | ADL83602.1 | 739 | Sequence 478 from patent US 7700736 |
GI:42794756 | GenBank | ADL85835.1 | 739 | Sequence 478 from patent US 7704496 |
GI:42794756 | GenBank | ADL95920.1 | 739 | Sequence 478 from patent US 7718173 |
GI:42794756 | GenBank | AFL59799.1 | 739 | Sequence 478 from patent US 8106156 |
GI:42794756 | GenBank | AHD78142.1 | 739 | Sequence 25479 from patent US 8586006 |
GI:42794758 | GenBank | AHD78143.1 | 683 | Sequence 25480 from patent US 8586006 |
GI:42794758 | GenBank | AHD78144.1 | 683 | Sequence 25481 from patent US 8586006 |
Related Sequences to LMP001504 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:42794758 | GenBank | ACG89468.1 | 739 | Sequence 478 from patent US 7385031 |
GI:42794758 | GenBank | ACG97372.1 | 739 | Sequence 478 from patent US 7390486 |
GI:42794758 | GenBank | ACH01181.1 | 739 | Sequence 478 from patent US 7390877 |
GI:42794758 | GenBank | ACH01457.1 | 739 | Sequence 478 from patent US 7390878 |
GI:42794758 | GenBank | ACH01848.1 | 739 | Sequence 478 from patent US 7390883 |
GI:42794758 | GenBank | ACH02579.1 | 739 | Sequence 478 from patent US 7390887 |
GI:42794756 | GenBank | ACM85099.1 | 734 | Sequence 10597 from patent US 6812339 |
GI:42794756 | GenBank | JAA16807.1 | 739 | acyl-CoA synthetase long-chain family member 5 [Pan troglodytes] |
GI:42794756 | GenBank | JAA31405.1 | 739 | acyl-CoA synthetase long-chain family member 5 [Pan troglodytes] |
GI:42794756 | RefSeq | XP_001146649.1 | 739 | PREDICTED: long-chain-fatty-acid--CoA ligase 5 isoform X1 [Pan troglodytes] |
GI:42794756 | RefSeq | XP_003825637.1 | 739 | PREDICTED: long-chain-fatty-acid--CoA ligase 5 isoform X1 [Pan paniscus] |
GI:42794756 | RefSeq | XP_004050154.1 | 739 | PREDICTED: long-chain-fatty-acid--CoA ligase 5 isoform 1 [Gorilla gorilla gorilla] |