Gene/Proteome Database (LMPD)

LMPD ID
LMP001522
Gene ID
Species
Homo sapiens (Human)
Gene Name
adiponectin receptor 2
Gene Symbol
Synonyms
ACDCR2; PAQR2
Alternate Names
adiponectin receptor protein 2; progestin and adipoQ receptor family member II
Chromosome
12
Map Location
12p13.31
Summary
The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).[supplied by OMIM, Mar 2008]
Orthologs

Proteins

adiponectin receptor protein 2
Refseq ID NP_078827
Protein GI 38261973
UniProt ID Q86V24
mRNA ID NM_024551
Length 386
RefSeq Status VALIDATED
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL

Gene Information

Entrez Gene ID
Gene Name
adiponectin receptor 2
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IBA:RefGenome C plasma membrane
GO:0042562 ISS:UniProtKB F hormone binding
GO:0004872 IBA:RefGenome F receptor activity
GO:0033211 IBA:RefGenome P adiponectin-activated signaling pathway
GO:0019395 ISS:UniProtKB P fatty acid oxidation
GO:0007565 IEA:Ensembl P female pregnancy
GO:0007507 IEA:Ensembl P heart development
GO:0009755 ISS:UniProtKB P hormone-mediated signaling pathway
GO:0030308 IEA:Ensembl P negative regulation of cell growth
GO:0046326 IEA:Ensembl P positive regulation of glucose import
GO:0007584 IEA:Ensembl P response to nutrient

KEGG Pathway Links

KEGG Pathway ID Description
hsa04152 AMPK signaling pathway
hsa04920 Adipocytokine signaling pathway
hsa04932 Non-alcoholic fatty liver disease (NAFLD)

Domain Information

InterPro Annotations

Accession Description
IPR004254 AdipoR/Haemolysin-III-related

UniProt Annotations

Entry Information

Gene Name
adiponectin receptor 2
Protein Entry
ADR2_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Domain The N-terminus is known to be cytoplasmic while the C- terminus is known to be extracellular.
Function Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some intermediate-affinity receptor activity for both globular and full-length adiponectin.
Interaction Q9UKG1:APPL1; NbExp=3; IntAct=EBI-1769445, EBI-741243;
Sequence Caution Sequence=BAB15062.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the ADIPOR family.
Subcellular Location Membrane ; Multi-pass membrane protein . Note=Localized to the cell membrane and intracellular organelles.
Subunit May form homomultimer and heteromultimers.
Tissue Specificity Highly expressed in skeletal muscle, liver and placenta. Weakly expressed in brain, heart, colon, spleen, kidney, thymus, small intestine, peripheral blood leukocytes and lung.
Web Resource Name=Wikipedia; Note=Adiponectin entry; URL="http://en.wikipedia.org/wiki/Adiponectin";

Identical and Related Proteins

Unique RefSeq proteins for LMP001522 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
38261973 RefSeq NP_078827 386 adiponectin receptor protein 2

Identical Sequences to LMP001522 proteins

Reference Database Accession Length Protein Name
GI:38261973 GenBank AHD75026.1 386 Sequence 16305 from patent US 8586006
GI:38261973 GenBank AIC52274.1 386 ADIPOR2, partial [synthetic construct]
GI:38261973 RefSeq XP_006719081.1 386 PREDICTED: adiponectin receptor protein 2 isoform X2 [Homo sapiens]
GI:38261973 RefSeq XP_008972049.1 386 PREDICTED: adiponectin receptor protein 2 isoform X1 [Pan paniscus]
GI:38261973 RefSeq XP_009422876.1 386 PREDICTED: adiponectin receptor protein 2 isoform X1 [Pan troglodytes]
GI:38261973 RefSeq XP_009422877.1 386 PREDICTED: adiponectin receptor protein 2 isoform X1 [Pan troglodytes]

Related Sequences to LMP001522 proteins

Reference Database Accession Length Protein Name
GI:38261973 GenBank JAA17851.1 386 adiponectin receptor 2 [Pan troglodytes]
GI:38261973 GenBank JAA34710.1 386 adiponectin receptor 2 [Pan troglodytes]
GI:38261973 GenBank JAA34711.1 386 adiponectin receptor 2 [Pan troglodytes]
GI:38261973 RefSeq XP_003273735.1 386 PREDICTED: adiponectin receptor protein 2 [Nomascus leucogenys]
GI:38261973 RefSeq XP_003905847.1 386 PREDICTED: adiponectin receptor protein 2 [Papio anubis]
GI:38261973 RefSeq XP_009245588.1 386 PREDICTED: adiponectin receptor protein 2 [Pongo abelii]