Gene/Proteome Database (LMPD)
LMPD ID
LMP001522
Gene ID
Species
Homo sapiens (Human)
Gene Name
adiponectin receptor 2
Gene Symbol
Synonyms
ACDCR2; PAQR2
Alternate Names
adiponectin receptor protein 2; progestin and adipoQ receptor family member II
Chromosome
12
Map Location
12p13.31
Summary
The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
| adiponectin receptor protein 2 | |
|---|---|
| Refseq ID | NP_078827 |
| Protein GI | 38261973 |
| UniProt ID | Q86V24 |
| mRNA ID | NM_024551 |
| Length | 386 |
| RefSeq Status | VALIDATED |
| MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IBA:RefGenome | C | plasma membrane |
| GO:0042562 | ISS:UniProtKB | F | hormone binding |
| GO:0004872 | IBA:RefGenome | F | receptor activity |
| GO:0033211 | IBA:RefGenome | P | adiponectin-activated signaling pathway |
| GO:0019395 | ISS:UniProtKB | P | fatty acid oxidation |
| GO:0007565 | IEA:Ensembl | P | female pregnancy |
| GO:0007507 | IEA:Ensembl | P | heart development |
| GO:0009755 | ISS:UniProtKB | P | hormone-mediated signaling pathway |
| GO:0030308 | IEA:Ensembl | P | negative regulation of cell growth |
| GO:0046326 | IEA:Ensembl | P | positive regulation of glucose import |
| GO:0007584 | IEA:Ensembl | P | response to nutrient |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004254 | AdipoR/Haemolysin-III-related |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Domain | The N-terminus is known to be cytoplasmic while the C- terminus is known to be extracellular. |
| Function | Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some intermediate-affinity receptor activity for both globular and full-length adiponectin. |
| Interaction | Q9UKG1:APPL1; NbExp=3; IntAct=EBI-1769445, EBI-741243; |
| Sequence Caution | Sequence=BAB15062.1; Type=Erroneous initiation; Evidence= ; |
| Similarity | Belongs to the ADIPOR family. |
| Subcellular Location | Membrane ; Multi-pass membrane protein . Note=Localized to the cell membrane and intracellular organelles. |
| Subunit | May form homomultimer and heteromultimers. |
| Tissue Specificity | Highly expressed in skeletal muscle, liver and placenta. Weakly expressed in brain, heart, colon, spleen, kidney, thymus, small intestine, peripheral blood leukocytes and lung. |
| Web Resource | Name=Wikipedia; Note=Adiponectin entry; URL="http://en.wikipedia.org/wiki/Adiponectin"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001522 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 38261973 | RefSeq | NP_078827 | 386 | adiponectin receptor protein 2 |
Identical Sequences to LMP001522 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:38261973 | GenBank | AHD75026.1 | 386 | Sequence 16305 from patent US 8586006 |
| GI:38261973 | GenBank | AIC52274.1 | 386 | ADIPOR2, partial [synthetic construct] |
| GI:38261973 | RefSeq | XP_006719081.1 | 386 | PREDICTED: adiponectin receptor protein 2 isoform X2 [Homo sapiens] |
| GI:38261973 | RefSeq | XP_008972049.1 | 386 | PREDICTED: adiponectin receptor protein 2 isoform X1 [Pan paniscus] |
| GI:38261973 | RefSeq | XP_009422876.1 | 386 | PREDICTED: adiponectin receptor protein 2 isoform X1 [Pan troglodytes] |
| GI:38261973 | RefSeq | XP_009422877.1 | 386 | PREDICTED: adiponectin receptor protein 2 isoform X1 [Pan troglodytes] |
Related Sequences to LMP001522 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:38261973 | GenBank | JAA17851.1 | 386 | adiponectin receptor 2 [Pan troglodytes] |
| GI:38261973 | GenBank | JAA34710.1 | 386 | adiponectin receptor 2 [Pan troglodytes] |
| GI:38261973 | GenBank | JAA34711.1 | 386 | adiponectin receptor 2 [Pan troglodytes] |
| GI:38261973 | RefSeq | XP_003273735.1 | 386 | PREDICTED: adiponectin receptor protein 2 [Nomascus leucogenys] |
| GI:38261973 | RefSeq | XP_003905847.1 | 386 | PREDICTED: adiponectin receptor protein 2 [Papio anubis] |
| GI:38261973 | RefSeq | XP_009245588.1 | 386 | PREDICTED: adiponectin receptor protein 2 [Pongo abelii] |