Gene/Proteome Database (LMPD)
LMPD ID
LMP001555
Gene ID
Species
Mus musculus (Mouse)
Gene Name
aldo-keto reductase family 1, member D1
Gene Symbol
Synonyms
-
Alternate Names
3-oxo-5-beta-steroid 4-dehydrogenase; delta(4)-3-oxosteroid 5-beta-reductase; delta(4)-3-ketosteroid 5-beta-reductase
Chromosome
6
Map Location
6 B1|6
EC Number
1.3.1.3
Proteins
3-oxo-5-beta-steroid 4-dehydrogenase | |
---|---|
Refseq ID | NP_663339 |
Protein GI | 21703734 |
UniProt ID | Q8VCX1 |
mRNA ID | NM_145364 |
Length | 325 |
RefSeq Status | VALIDATED |
MNLSAAHHQISLSDGNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIAEGKVKREEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMAFKPGKEIYPRDENGRIIYDKTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFTQTKLLKFCQQHDIVIVAHSPLGTCRNPSWVNVSSPPLLNDELLTSLGKKYNKTQAQIVLRFNIQRGIVVIPKSFTPERIKENFQIFDFSLTEEEMKDIDALNKNVRYVELLMWSDHPEYPFHDEY |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member D1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IEA:Ensembl | C | cytosol |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0047787 | IEA:UniProtKB-EC | F | delta4-3-oxosteroid 5beta-reductase activity |
GO:0008209 | IEA:Ensembl | P | androgen metabolic process |
GO:0006699 | IEA:Ensembl | P | bile acid biosynthetic process |
GO:0030573 | IEA:UniProtKB-KW | P | bile acid catabolic process |
GO:0008207 | IEA:Ensembl | P | C21-steroid hormone metabolic process |
GO:0006707 | IEA:Ensembl | P | cholesterol catabolic process |
GO:0007586 | IEA:Ensembl | P | digestion |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu00120 | Primary bile acid biosynthesis |
mmu00140 | Steroid hormone biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 1, member D1
Protein Entry
AK1D1_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 17,21-dihydroxy-5-beta-pregnane-3,11,20-trione + NADP(+) = cortisone. |
Catalytic Activity | 5-beta-cholestan-3-one + NADP(+) = cholest-4- en-3-one + NADPH. |
Function | Efficiently catalyzes the reduction of progesterone, androstenedione, 17-alpha-hydroxyprogesterone and testosterone to 5-beta-reduced metabolites. The bile acid intermediates 7- alpha,12-alpha-dihydroxy-4-cholesten-3-one and 7-alpha-hydroxy-4- cholesten-3-one can also act as substrates. |
Similarity | Belongs to the aldo/keto reductase family. {ECO:0000305}. |
Subcellular Location | Cytoplasm {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001555 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
21703734 | RefSeq | NP_663339 | 325 | 3-oxo-5-beta-steroid 4-dehydrogenase |
Identical Sequences to LMP001555 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:21703734 | GenBank | AAH18333.1 | 325 | Aldo-keto reductase family 1, member D1 [Mus musculus] |
GI:21703734 | GenBank | EDL13653.1 | 325 | aldo-keto reductase family 1, member D1 [Mus musculus] |
GI:21703734 | RefSeq | XP_006505888.1 | 325 | PREDICTED: 3-oxo-5-beta-steroid 4-dehydrogenase isoform X1 [Mus musculus] |
GI:21703734 | SwissProt | Q8VCX1.1 | 325 | RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase; AltName: Full=Aldo-keto reductase family 1 member D1; AltName: Full=Delta(4)-3-ketosteroid 5-beta-reductase; AltName: Full=Delta(4)-3-oxosteroid 5-beta-reductase [Mus musculus] |
Related Sequences to LMP001555 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:21703734 | GenBank | EDM15344.1 | 325 | rCG27878 [Rattus norvegicus] |
GI:21703734 | RefSeq | NP_620239.1 | 326 | 3-oxo-5-beta-steroid 4-dehydrogenase [Rattus norvegicus] |
GI:21703734 | RefSeq | XP_003503275.1 | 325 | PREDICTED: 3-oxo-5-beta-steroid 4-dehydrogenase isoform X1 [Cricetulus griseus] |
GI:21703734 | RefSeq | XP_005365890.1 | 325 | PREDICTED: 3-oxo-5-beta-steroid 4-dehydrogenase isoform X1 [Microtus ochrogaster] |
GI:21703734 | RefSeq | XP_007615706.1 | 325 | PREDICTED: 3-oxo-5-beta-steroid 4-dehydrogenase isoform X1 [Cricetulus griseus] |
GI:21703734 | SwissProt | P31210.1 | 326 | RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase; AltName: Full=Aldo-keto reductase family 1 member D1; AltName: Full=Delta(4)-3-ketosteroid 5-beta-reductase; AltName: Full=Delta(4)-3-oxosteroid 5-beta-reductase [Rattus norvegicus] |