Gene/Proteome Database (LMPD)

LMPD ID
LMP001555
Gene ID
Species
Mus musculus (Mouse)
Gene Name
aldo-keto reductase family 1, member D1
Gene Symbol
Synonyms
-
Alternate Names
3-oxo-5-beta-steroid 4-dehydrogenase; delta(4)-3-oxosteroid 5-beta-reductase; delta(4)-3-ketosteroid 5-beta-reductase
Chromosome
6
Map Location
6 B1|6
EC Number
1.3.1.3

Proteins

3-oxo-5-beta-steroid 4-dehydrogenase
Refseq ID NP_663339
Protein GI 21703734
UniProt ID Q8VCX1
mRNA ID NM_145364
Length 325
RefSeq Status VALIDATED
MNLSAAHHQISLSDGNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIAEGKVKREEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMAFKPGKEIYPRDENGRIIYDKTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFTQTKLLKFCQQHDIVIVAHSPLGTCRNPSWVNVSSPPLLNDELLTSLGKKYNKTQAQIVLRFNIQRGIVVIPKSFTPERIKENFQIFDFSLTEEEMKDIDALNKNVRYVELLMWSDHPEYPFHDEY

Gene Information

Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member D1
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IEA:Ensembl C cytosol
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0047787 IEA:UniProtKB-EC F delta4-3-oxosteroid 5beta-reductase activity
GO:0008209 IEA:Ensembl P androgen metabolic process
GO:0006699 IEA:Ensembl P bile acid biosynthetic process
GO:0030573 IEA:UniProtKB-KW P bile acid catabolic process
GO:0008207 IEA:Ensembl P C21-steroid hormone metabolic process
GO:0006707 IEA:Ensembl P cholesterol catabolic process
GO:0007586 IEA:Ensembl P digestion

KEGG Pathway Links

KEGG Pathway ID Description
mmu00120 Primary bile acid biosynthesis
mmu00140 Steroid hormone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5893443 Synthesis of bile acids and bile salts via 24-hydroxycholesterol
5893439 Synthesis of bile acids and bile salts via 27-hydroxycholesterol

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR018170 Aldo/keto reductase, conserved site
IPR020471 Aldo/keto reductase subgroup
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 1, member D1
Protein Entry
AK1D1_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity 17,21-dihydroxy-5-beta-pregnane-3,11,20-trione + NADP(+) = cortisone.
Catalytic Activity 5-beta-cholestan-3-one + NADP(+) = cholest-4- en-3-one + NADPH.
Function Efficiently catalyzes the reduction of progesterone, androstenedione, 17-alpha-hydroxyprogesterone and testosterone to 5-beta-reduced metabolites. The bile acid intermediates 7- alpha,12-alpha-dihydroxy-4-cholesten-3-one and 7-alpha-hydroxy-4- cholesten-3-one can also act as substrates.
Similarity Belongs to the aldo/keto reductase family. {ECO:0000305}.
Subcellular Location Cytoplasm {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001555 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21703734 RefSeq NP_663339 325 3-oxo-5-beta-steroid 4-dehydrogenase

Identical Sequences to LMP001555 proteins

Reference Database Accession Length Protein Name
GI:21703734 GenBank AAH18333.1 325 Aldo-keto reductase family 1, member D1 [Mus musculus]
GI:21703734 GenBank EDL13653.1 325 aldo-keto reductase family 1, member D1 [Mus musculus]
GI:21703734 RefSeq XP_006505888.1 325 PREDICTED: 3-oxo-5-beta-steroid 4-dehydrogenase isoform X1 [Mus musculus]
GI:21703734 SwissProt Q8VCX1.1 325 RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase; AltName: Full=Aldo-keto reductase family 1 member D1; AltName: Full=Delta(4)-3-ketosteroid 5-beta-reductase; AltName: Full=Delta(4)-3-oxosteroid 5-beta-reductase [Mus musculus]

Related Sequences to LMP001555 proteins

Reference Database Accession Length Protein Name
GI:21703734 GenBank EDM15344.1 325 rCG27878 [Rattus norvegicus]
GI:21703734 RefSeq NP_620239.1 326 3-oxo-5-beta-steroid 4-dehydrogenase [Rattus norvegicus]
GI:21703734 RefSeq XP_003503275.1 325 PREDICTED: 3-oxo-5-beta-steroid 4-dehydrogenase isoform X1 [Cricetulus griseus]
GI:21703734 RefSeq XP_005365890.1 325 PREDICTED: 3-oxo-5-beta-steroid 4-dehydrogenase isoform X1 [Microtus ochrogaster]
GI:21703734 RefSeq XP_007615706.1 325 PREDICTED: 3-oxo-5-beta-steroid 4-dehydrogenase isoform X1 [Cricetulus griseus]
GI:21703734 SwissProt P31210.1 326 RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase; AltName: Full=Aldo-keto reductase family 1 member D1; AltName: Full=Delta(4)-3-ketosteroid 5-beta-reductase; AltName: Full=Delta(4)-3-oxosteroid 5-beta-reductase [Rattus norvegicus]