Gene/Proteome Database (LMPD)
LMPD ID
LMP001607
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidylinositol-specific phospholipase C, X domain containing 1
Gene Symbol
Synonyms
-
Alternate Names
PI-PLC X domain-containing protein 1
Chromosome
X|Y
Map Location
Xp22.33; Yp11.32
Summary
This gene is the most terminal protein-coding gene in the pseudoautosomal (PAR) region on chromosomes X and Y. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Orthologs
Proteins
PI-PLC X domain-containing protein 1 | |
---|---|
Refseq ID | NP_060860 |
Protein GI | 8922995 |
UniProt ID | Q9NUJ7 |
mRNA ID | NM_018390 |
Length | 323 |
RefSeq Status | REVIEWED |
MGGQVSASNSFSRLHCRNANEDWMSALCPRLWDVPLHHLSIPGSHDTMTYCLNKKSPISHEESRLLQLLNKALPCITRPVVLKWSVTQALDVTEQLDAGVRYLDLRIAHMLEGSEKNLHFVHMVYTTALVEDTLTEISEWLERHPREVVILACRNFEGLSEDLHEYLVACIKNIFGDMLCPRGEVPTLRQLWSRGQQVIVSYEDESSLRRHHELWPGVPYWWGNRVKTEALIRYLETMKSCGRPGGLFVAGINLTENLQYVLAHPSESLEKMTLPNLPRLSAWVREQCPGPGSRCTNIIAGDFIGADGFVSDVIALNQKLLWC |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol-specific phospholipase C, X domain containing 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008081 | IEA:InterPro | F | phosphoric diester hydrolase activity |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol-specific phospholipase C, X domain containing 1
Protein Entry
PLCX1_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Miscellaneous | The gene coding for this protein is located in the pseudoautosomal region 1 (PAR1) of X and Y chromosomes. |
Sequence Caution | Sequence=CAM28359.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=CAM28360.1; Type=Erroneous gene model prediction; Evidence= ; |
Similarity | Contains 1 PI-PLC X-box domain. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP001607 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
8922995 | RefSeq | NP_060860 | 323 | PI-PLC X domain-containing protein 1 |
Identical Sequences to LMP001607 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:8922995 | GenBank | AIC56683.1 | 323 | PLCXD1, partial [synthetic construct] |
GI:8922995 | RefSeq | XP_006724508.1 | 323 | PREDICTED: PI-PLC X domain-containing protein 1 isoform X2 [Homo sapiens] |
GI:8922995 | RefSeq | XP_006724509.1 | 323 | PREDICTED: PI-PLC X domain-containing protein 1 isoform X3 [Homo sapiens] |
GI:8922995 | RefSeq | XP_006724928.1 | 323 | PREDICTED: PI-PLC X domain-containing protein 1 isoform X4 [Homo sapiens] |
GI:8922995 | RefSeq | XP_006724929.1 | 323 | PREDICTED: PI-PLC X domain-containing protein 1 isoform X5 [Homo sapiens] |
GI:8922995 | RefSeq | XP_006724930.1 | 323 | PREDICTED: PI-PLC X domain-containing protein 1 isoform X6 [Homo sapiens] |
Related Sequences to LMP001607 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:8922995 | GenBank | JAA04479.1 | 323 | phosphatidylinositol-specific phospholipase C, X domain containing 1 [Pan troglodytes] |
GI:8922995 | GenBank | JAA16843.1 | 323 | phosphatidylinositol-specific phospholipase C, X domain containing 1 [Pan troglodytes] |
GI:8922995 | GenBank | JAA22539.1 | 323 | phosphatidylinositol-specific phospholipase C, X domain containing 1 [Pan troglodytes] |
GI:8922995 | GenBank | JAA38588.1 | 323 | phosphatidylinositol-specific phospholipase C, X domain containing 1 [Pan troglodytes] |
GI:8922995 | RefSeq | XP_009197589.1 | 323 | PREDICTED: PI-PLC X domain-containing protein 1 isoform X2 [Papio anubis] |
GI:8922995 | RefSeq | XP_009197590.1 | 323 | PREDICTED: PI-PLC X domain-containing protein 1 isoform X3 [Papio anubis] |