Gene/Proteome Database (LMPD)
LMPD ID
LMP001700
Gene ID
Species
Mus musculus (Mouse)
Gene Name
nuclear receptor subfamily 1, group I, member 2
Gene Symbol
Synonyms
PXR; PXR.1; PXR.2; PXR1; SXR; mPXR
Alternate Names
nuclear receptor subfamily 1 group I member 2; Pregnane X receptor; orphan nuclear receptor PXR
Chromosome
16
Map Location
16 B3|16
Proteins
| nuclear receptor subfamily 1 group I member 2 isoform 1 | |
|---|---|
| Refseq ID | NP_035066 |
| Protein GI | 33468913 |
| UniProt ID | O54915 |
| mRNA ID | NM_010936 |
| Length | 431 |
| RefSeq Status | VALIDATED |
| MRPEESWSRVGLVQCEEADSALEEPINVEEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSGCELPEFLQASLLEDPATWSQIMKDRVPMKISLQLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISYFRDLPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLHKEEYVLMQAISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDSHPFATPLMQELFSSTDG | |
| nuclear receptor subfamily 1 group I member 2 isoform 2 | |
|---|---|
| Refseq ID | NP_001091874 |
| Protein GI | 148536879 |
| UniProt ID | O54915 |
| mRNA ID | NM_001098404 |
| Length | 390 |
| RefSeq Status | VALIDATED |
| MRPEESWSRVGLVQCEEADSALEEPINVEEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISYFRDLPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLHKEEYVLMQAISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDSHPFATPLMQELFSSTDG | |
Gene Information
Entrez Gene ID
Gene Name
nuclear receptor subfamily 1, group I, member 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IEA:UniProtKB-KW | C | nucleus |
| GO:0000977 | IEA:Ensembl | F | RNA polymerase II regulatory region sequence-specific DNA binding |
| GO:0001228 | IEA:Ensembl | F | RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription |
| GO:0008144 | ISS:UniProtKB | F | drug binding |
| GO:0004879 | ISS:UniProtKB | F | ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity |
| GO:0003707 | IEA:InterPro | F | steroid hormone receptor activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
| GO:0046618 | ISS:UniProtKB | P | drug export |
| GO:0042738 | ISS:UniProtKB | P | exogenous drug catabolic process |
| GO:0045892 | ISO:MGI | P | negative regulation of transcription, DNA-templated |
| GO:0010628 | IMP:MGI | P | positive regulation of gene expression |
| GO:0045893 | ISS:UniProtKB | P | positive regulation of transcription, DNA-templated |
| GO:0006805 | ISS:UniProtKB | P | xenobiotic metabolic process |
| GO:0042908 | ISS:UniProtKB | P | xenobiotic transport |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
nuclear receptor subfamily 1, group I, member 2
Protein Entry
NR1I2_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=PXR.1; IsoId=O54915-1; Sequence=Displayed; Name=2; Synonyms=PXR.2; IsoId=O54915-2; Sequence=VSP_003670; |
| Function | Nuclear receptor that binds and is activated by a variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, endogenous compounds and drugs. Response to specific ligands is species-specific, due to differences in the ligand- binding domain. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes (By similarity). Activated by naturally occurring steroids such as pregnenolone and progesterone, the cholesterol metabolite 5-beta-cholestane-3- alpha,7-alpha,12-alpha-triol, synthetic glucocorticoids and antiglucocorticoids and 16-alpha-carbonitrile (PCN). {ECO:0000250, ECO:0000269|PubMed:12569201, ECO:0000269|PubMed:19297428}. |
| Similarity | Belongs to the nuclear hormone receptor family. NR1 subfamily. {ECO:0000305}. |
| Similarity | Contains 1 nuclear receptor DNA-binding domain. {ECO:0000255|PROSITE-ProRule:PRU00407}. |
| Subcellular Location | Nucleus {ECO:0000255|PROSITE- ProRule:PRU00407}. |
| Subunit | Heterodimer with RXRA. Interacts with NCOA1 (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001700 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 33468913 | RefSeq | NP_035066 | 431 | nuclear receptor subfamily 1 group I member 2 isoform 1 |
| 148536879 | RefSeq | NP_001091874 | 390 | nuclear receptor subfamily 1 group I member 2 isoform 2 |
Identical Sequences to LMP001700 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:33468913 | DBBJ | BAB31316.1 | 431 | unnamed protein product [Mus musculus] |
| GI:33468913 | GenBank | AAI20797.1 | 431 | Nuclear receptor subfamily 1, group I, member 2 [Mus musculus] |
| GI:33468913 | GenBank | EDK97971.1 | 431 | nuclear receptor subfamily 1, group I, member 2 [Mus musculus] |
| GI:33468913 | GenBank | AAI37781.1 | 431 | Nuclear receptor subfamily 1, group I, member 2 [Mus musculus] |
| GI:33468913 | RefSeq | XP_006521909.1 | 431 | PREDICTED: nuclear receptor subfamily 1 group I member 2 isoform X1 [Mus musculus] |
| GI:33468913 | RefSeq | XP_006521911.1 | 431 | PREDICTED: nuclear receptor subfamily 1 group I member 2 isoform X3 [Mus musculus] |
Related Sequences to LMP001700 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:148536879 | GenBank | AAC39964.1 | 431 | pregnane X receptor [Mus musculus] |
| GI:33468913 | GenBank | AAD47214.1 | 431 | pregnane X receptor [Rattus norvegicus] |
| GI:148536879 | GenBank | EDK97971.1 | 431 | nuclear receptor subfamily 1, group I, member 2 [Mus musculus] |
| GI:33468913 | GenBank | EDM11231.1 | 431 | nuclear receptor subfamily 1, group I, member 2 [Rattus norvegicus] |
| GI:33468913 | RefSeq | NP_443212.1 | 431 | nuclear receptor subfamily 1 group I member 2 [Rattus norvegicus] |
| GI:148536879 | RefSeq | NP_035066.1 | 431 | nuclear receptor subfamily 1 group I member 2 isoform 1 [Mus musculus] |
| GI:148536879 | RefSeq | XP_006521909.1 | 431 | PREDICTED: nuclear receptor subfamily 1 group I member 2 isoform X1 [Mus musculus] |
| GI:148536879 | RefSeq | XP_006521911.1 | 431 | PREDICTED: nuclear receptor subfamily 1 group I member 2 isoform X3 [Mus musculus] |
| GI:33468913 | RefSeq | XP_006975795.1 | 432 | PREDICTED: nuclear receptor subfamily 1 group I member 2 isoform X1 [Peromyscus maniculatus bairdii] |
| GI:33468913 | RefSeq | XP_006975796.1 | 432 | PREDICTED: nuclear receptor subfamily 1 group I member 2 isoform X2 [Peromyscus maniculatus bairdii] |
| GI:148536879 | SwissProt | O54915.1 | 431 | RecName: Full=Nuclear receptor subfamily 1 group I member 2; AltName: Full=Orphan nuclear receptor PXR; AltName: Full=Pregnane X receptor [Mus musculus] |
| GI:33468913 | SwissProt | Q9R1A7.1 | 431 | RecName: Full=Nuclear receptor subfamily 1 group I member 2; AltName: Full=Orphan nuclear receptor PXR; AltName: Full=Pregnane X receptor [Rattus norvegicus] |