Gene/Proteome Database (LMPD)

LMPD ID
LMP001702
Gene ID
6554
Species
Homo sapiens (Human)
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 1
Gene Symbol
SLC10A1
Synonyms
NTCP
Chromosome
14
Map Location
14q24.1
Summary
The protein encoded by this gene belongs to the sodium/bile acid cotransporter family, which are integral membrane glycoproteins that participate in the enterohepatic circulation of bile acids. Two homologous transporters are involved in the reabsorption of bile acids; the ileal sodium/bile acid cotransporter with an apical cell localization that absorbs bile acids from the intestinal lumen, bile duct and kidney, and the liver-specific sodium/bile acid cotransporter, represented by this protein, that is found in the basolateral membranes of hepatocytes. Bile acids are the catabolic product of cholesterol metabolism, hence this protein is important for cholesterol homeostasis. [provided by RefSeq, Oct 2011]
Orthologs
View orthologs and multiple alignments for SLC10A1

Proteins

sodium/bile acid cotransporter
Refseq ID NP_003040
Protein GI 4506971
UniProt ID Q14973
mRNA ID NM_003049
Length 349
RefSeq Status REVIEWED
MEAHNASAPFNFTLPPNFGKRPTDLALSVILVFMLFFIMLSLGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAINVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFPPEVIGPLFFFPLLYMIFQLGEGLLLIAIFWCYEKFKTPKDKTKMIYTAATTEETIPGALGNGTYKGEDCSPCTA

Gene Information

Entrez Gene ID
6554
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 1
Gene Symbol
SLC10A1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:InterPro C integral component of membrane
GO:0008508 IEA:InterPro F bile acid:sodium symporter activity

KEGG Pathway Links

KEGG Pathway ID Description
hsa04976 Bile secretion
ko04976 Bile secretion

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_11042 Recycling of bile acids and salts

Domain Information

InterPro Annotations

Accession Description
IPR004710 Bile acid:sodium symporter
IPR002657 Bile acid:sodium symporter/arsenical resistance protein Acr3

UniProt Annotations

Entry Information

Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 1
Protein Entry
NTCP_HUMAN
UniProt ID
Q14973
Species
Human

Identical and Related Proteins

Unique RefSeq proteins for LMP001702 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4506971 RefSeq NP_003040 349 sodium/bile acid cotransporter

Identical Sequences to LMP001702 proteins

Reference Database Accession Length Protein Name
GI:4506971 GenBank ADQ31923.1 349 solute carrier family 10 (sodium/bile acid cotransporter family), member 1, partial [synthetic construct]
GI:4506971 GenBank ADR82943.1 349 solute carrier family 10 (sodium/bile acid cotransporter family), member 1, partial [synthetic construct]
GI:4506971 GenBank AEK13685.1 349 Sequence 97 from patent US 7972785
GI:4506971 GenBank AGD01447.1 349 Sequence 970 from patent US 8338124
GI:4506971 GenBank AHE01370.1 349 Sequence 56286 from patent US 8586006
GI:4506971 GenBank AIC49740.1 349 SLC10A1, partial [synthetic construct]

Related Sequences to LMP001702 proteins

Reference Database Accession Length Protein Name
GI:4506971 DBBJ BAG36738.1 349 unnamed protein product [Homo sapiens]
GI:4506971 GenBank ACM82047.1 376 Sequence 7545 from patent US 6812339
GI:4506971 GenBank AFL02669.1 349 Na+-taurocholate cotransporting polypeptide [Homo sapiens]
GI:4506971 RefSeq XP_510035.2 349 PREDICTED: sodium/bile acid cotransporter [Pan troglodytes]
GI:4506971 RefSeq XP_002824936.1 349 PREDICTED: sodium/bile acid cotransporter [Pongo abelii]
GI:4506971 RefSeq XP_003824149.1 349 PREDICTED: sodium/bile acid cotransporter [Pan paniscus]