Gene/Proteome Database (LMPD)
Proteins
| apolipoprotein L6 isoform 1 | |
|---|---|
| Refseq ID | NP_082286 |
| Protein GI | 254692884 |
| UniProt ID | Q9D6L7 |
| mRNA ID | NM_028010 |
| Length | 321 |
| RefSeq Status | VALIDATED |
| MALVQTPTPSHQTEEDYEADAELLRDKDDSPLDVEDDVLFLKQFPSWRKKEKKRIRTLYAIADHIDESHQKATKIKVVTTSASVASGVLSLLGLALATTTAGGSLVLTAVGHGLGAVAGVTEIVTNVRKNSRNKRALAQVNSIMPNSDQELEGVKGEKTTFVTAAGDLVYKCGNAWDNIKKHLRALQLTRTQPHVTSAAKKLMTAGHVSARSGRQVQKAFGGTALAMTKNALRMGRAAAALSLGQDIYTLWEDWKDLKAANPTELAEELRARAAERERVLAEHTCRYRKLQRLSKEAARSSLKGNKVTQPPSSSTERARLW | |
| apolipoprotein L6 isoform 2 | |
|---|---|
| Refseq ID | NP_001157093 |
| Protein GI | 254692886 |
| UniProt ID | Q3UN08 |
| mRNA ID | NM_001163621 |
| Length | 329 |
| RefSeq Status | VALIDATED |
| MALVQTPTPSHQTEEDYEADAELLRDKDDSPLDVEDDVLFLKQFPSWRKKEKKRIRTLYAIADHIDESHQKATKIKVVTTSASVASGVLSLLGLALATTTAGGSLVLTAVGHGLGAVAGVTEIVTNVRKNSRNKRALAQVNSIMPNSDQELEGVKGEKTTFVTAAGDLVYKCGNAWDNIKKHLRALQLTRTQPHVTSAAKKLMTAGHVSARSGRQVQKAFGGTALAMTKNALRMGRAAAALSLGQDIYTLWEDWKDLKAANPTELAEELRARAAERERVLAEHTCRYRKLQVRVGFYLLLLLFVFLLELRTDPRALFLLGKHSTTELNL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:InterPro | C | extracellular region |
| GO:0008289 | IEA:InterPro | F | lipid binding |
| GO:0006869 | IEA:InterPro | P | lipid transport |
| GO:0042157 | IEA:InterPro | P | lipoprotein metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008405 | Apolipoprotein L |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP001712 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 254692884 | RefSeq | NP_082286 | 321 | apolipoprotein L6 isoform 1 |
| 254692886 | RefSeq | NP_001157093 | 329 | apolipoprotein L6 isoform 2 |
Identical Sequences to LMP001712 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254692886 | RefSeq | XP_006521482.1 | 329 | PREDICTED: apolipoprotein L6 isoform X1 [Mus musculus] |
| GI:254692886 | RefSeq | XP_006521483.1 | 329 | PREDICTED: apolipoprotein L6 isoform X2 [Mus musculus] |
| GI:254692884 | RefSeq | XP_006521484.1 | 321 | PREDICTED: apolipoprotein L6 isoform X3 [Mus musculus] |
Related Sequences to LMP001712 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:254692886 | DBBJ | BAB26769.1 | 321 | unnamed protein product [Mus musculus] |
| GI:254692884 | DBBJ | BAB26769.1 | 321 | unnamed protein product [Mus musculus] |
| GI:254692884 | DBBJ | BAE25940.1 | 381 | unnamed protein product, partial [Mus musculus] |
| GI:254692886 | DBBJ | BAE25940.1 | 381 | unnamed protein product, partial [Mus musculus] |
| GI:254692886 | RefSeq | NP_082286.1 | 321 | apolipoprotein L6 isoform 1 [Mus musculus] |
| GI:254692884 | RefSeq | NP_001157093.1 | 329 | apolipoprotein L6 isoform 2 [Mus musculus] |
| GI:254692886 | RefSeq | XP_005354336.1 | 343 | PREDICTED: apolipoprotein L6 [Microtus ochrogaster] |
| GI:254692884 | RefSeq | XP_006521482.1 | 329 | PREDICTED: apolipoprotein L6 isoform X1 [Mus musculus] |
| GI:254692884 | RefSeq | XP_006521483.1 | 329 | PREDICTED: apolipoprotein L6 isoform X2 [Mus musculus] |
| GI:254692886 | RefSeq | XP_006521484.1 | 321 | PREDICTED: apolipoprotein L6 isoform X3 [Mus musculus] |
| GI:254692886 | RefSeq | XP_006995686.1 | 431 | PREDICTED: apolipoprotein L6 [Peromyscus maniculatus bairdii] |
| GI:254692884 | RefSeq | XP_006995686.1 | 431 | PREDICTED: apolipoprotein L6 [Peromyscus maniculatus bairdii] |