Gene/Proteome Database (LMPD)

LMPD ID
LMP001725
Gene ID
Species
Mus musculus (Mouse)
Gene Name
fatty acid binding protein 7, brain
Gene Symbol
Synonyms
B-FABP; BFABP; Blbp; MRG
Alternate Names
fatty acid-binding protein, brain; brain lipid binding protein; brain lipid-binding protein; fatty acid-binding protein 7; brain-type fatty acid-binding protein; mammary-derived growth inhibitor-related
Chromosome
10
Map Location
10 B4|10

Proteins

fatty acid-binding protein, brain
Refseq ID NP_067247
Protein GI 10946572
UniProt ID P51880
mRNA ID NM_021272
Length 132
RefSeq Status VALIDATED
MVDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEINFQLGEEFEETSIDDRNCKSVVRLDGDKLIHVQKWDGKETNCTREIKDGKMVVTLTFGDIVAVRCYEKA

Gene Information

Entrez Gene ID
Gene Name
fatty acid binding protein 7, brain
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0044297 IDA:MGI C cell body
GO:0042995 IDA:MGI C cell projection
GO:0005829 TAS:BHF-UCL C cytosol
GO:0043025 IDA:MGI C neuronal cell body
GO:0005634 IEA:Ensembl C nucleus
GO:0005504 TAS:BHF-UCL F fatty acid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0021846 IMP:MGI P cell proliferation in forebrain
GO:0050673 IEA:Ensembl P epithelial cell proliferation
GO:0022008 IMP:MGI P neurogenesis
GO:0060134 IMP:MGI P prepulse inhibition
GO:0001964 IMP:MGI P startle response

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
mmu03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 7, brain
Protein Entry
FABP7_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior. {ECO:0000250}.
Function B-FABP could be involved in the transport of a so far unknown hydrophobic ligand with potential morphogenic activity during CNS development. It is required for the establishment of the radial glial fiber system in developing brain, a system that is necessary for the migration of immature neurons to establish cortical layers.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. {ECO:0000305}.
Subcellular Location Cytoplasm.
Tissue Specificity Expressed in brain and other neural tissues.

Identical and Related Proteins

Unique RefSeq proteins for LMP001725 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
10946572 RefSeq NP_067247 132 fatty acid-binding protein, brain

Identical Sequences to LMP001725 proteins

Reference Database Accession Length Protein Name
GI:10946572 DBBJ BAB22478.1 132 unnamed protein product [Mus musculus]
GI:10946572 DBBJ BAB32356.1 132 unnamed protein product [Mus musculus]
GI:10946572 EMBL CAJ18607.1 132 Fabp7 [Mus musculus]
GI:10946572 GenBank AAH55280.1 132 Fatty acid binding protein 7, brain [Mus musculus]
GI:10946572 GenBank AAH57090.1 132 Fatty acid binding protein 7, brain [Mus musculus]
GI:10946572 GenBank AFK98790.1 132 Sequence 34 from patent US 8163289

Related Sequences to LMP001725 proteins

Reference Database Accession Length Protein Name
GI:10946572 EMBL CAI35910.1 132 fatty acid binding protein 7, brain [Mus musculus]
GI:10946572 GenBank AAA60455.1 132 fatty acid binding protein [Rattus norvegicus]
GI:10946572 GenBank EDL05123.1 155 fatty acid binding protein 7, brain, partial [Mus musculus]
GI:10946572 GenBank EDL92887.1 132 fatty acid binding protein 7, brain, isoform CRA_a [Rattus norvegicus]
GI:10946572 RefSeq NP_110459.1 132 fatty acid-binding protein, brain [Rattus norvegicus]
GI:10946572 SwissProt P55051.2 132 RecName: Full=Fatty acid-binding protein, brain; AltName: Full=Brain lipid-binding protein; Short=BLBP; AltName: Full=Brain-type fatty acid-binding protein; Short=B-FABP; AltName: Full=Fatty acid-binding protein 7 [Rattus norvegicus]