Gene/Proteome Database (LMPD)
LMPD ID
LMP001730
Gene ID
Species
Homo sapiens (Human)
Gene Name
inositol hexakisphosphate kinase 3
Gene Symbol
Synonyms
IHPK3; INSP6K3
Chromosome
6
Map Location
6p21.31
Summary
This gene encodes a protein that belongs to the inositol phosphokinase (IPK) family. This protein is likely responsible for the conversion of inositol hexakisphosphate (InsP6) to diphosphoinositol pentakisphosphate (InsP7/PP-InsP5). It may also convert 1,3,4,5,6-pentakisphosphate (InsP5) to PP-InsP4. Alternative splicing results in multiple transcript variants encoding the same protein.[provided by RefSeq, Dec 2008]
Orthologs
Proteins
| inositol hexakisphosphate kinase 3 | |
|---|---|
| Refseq ID | NP_001136355 |
| Protein GI | 218777830 |
| UniProt ID | Q96PC2 |
| mRNA ID | NM_001142883 |
| Length | 410 |
| RefSeq Status | REVIEWED |
| MVVQNSADAGDMRAGVQLEPFLHQVGGHMSVMKYDEHTVCKPLVSREQRFYESLPLAMKRFTPQYKGTVTVHLWKDSTGHLSLVANPVKESQEPFKVSTESAAVAIWQTLQQTTGSNGSDCTLAQWPHAQLARSPKESPAKALLRSEPHLNTPAFSLVEDTNGNQVERKSFNPWGLQCHQAHLTRLCSEYPENKRHRFLLLENVVSQYTHPCVLDLKMGTRQHGDDASEEKKARHMRKCAQSTSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGFRQALYQFLHNGSHLRRELLEPILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHEAPQAAHGSSPGGLTKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQDIQEGE | |
Gene Information
Entrez Gene ID
Gene Name
inositol hexakisphosphate kinase 3
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008440 | IEA:InterPro | F | inositol-1,4,5-trisphosphate 3-kinase activity |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-6369 | inositol pyrophosphates biosynthesis |
| PWY-6371 | superpathway of inositol phosphate compounds |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150154 | Inositol phosphate metabolism |
| REACT_150188 | Synthesis of pyrophosphates in the cytosol |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005522 | Inositol polyphosphate kinase |
UniProt Annotations
Entry Information
Gene Name
inositol hexakisphosphate kinase 3
Protein Entry
IP6K3_HUMAN
UniProt ID
Species
Human
Identical and Related Proteins
Unique RefSeq proteins for LMP001730 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 218777830 | RefSeq | NP_001136355 | 410 | inositol hexakisphosphate kinase 3 |
Identical Sequences to LMP001730 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:218777830 | GenBank | EAX03748.1 | 410 | inositol hexaphosphate kinase 3, isoform CRA_a [Homo sapiens] |
| GI:218777830 | GenBank | EAX03749.1 | 410 | inositol hexaphosphate kinase 3, isoform CRA_a [Homo sapiens] |
| GI:218777830 | GenBank | AHE00920.1 | 410 | Sequence 54940 from patent US 8586006 |
| GI:218777830 | GenBank | AIC57594.1 | 410 | IP6K3, partial [synthetic construct] |
| GI:218777830 | RefSeq | XP_005248899.1 | 410 | PREDICTED: inositol hexakisphosphate kinase 3 isoform X1 [Homo sapiens] |
| GI:218777830 | SwissProt | Q96PC2.2 | 410 | RecName: Full=Inositol hexakisphosphate kinase 3; Short=InsP6 kinase 3; AltName: Full=Inositol hexaphosphate kinase 3 [Homo sapiens] |
Related Sequences to LMP001730 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:218777830 | DBBJ | BAD97292.1 | 410 | inositol hexaphosphate kinase 3 variant, partial [Homo sapiens] |
| GI:218777830 | DBBJ | BAF82624.1 | 410 | unnamed protein product [Homo sapiens] |
| GI:218777830 | GenBank | AAL17053.1 | 410 | inositol hexakisphosphate kinase 3 [Homo sapiens] |
| GI:218777830 | RefSeq | XP_003311275.1 | 410 | PREDICTED: inositol hexakisphosphate kinase 3 [Pan troglodytes] |
| GI:218777830 | RefSeq | XP_004043884.1 | 410 | PREDICTED: inositol hexakisphosphate kinase 3 isoform 1 [Gorilla gorilla gorilla] |
| GI:218777830 | RefSeq | XP_004043885.1 | 410 | PREDICTED: inositol hexakisphosphate kinase 3 isoform 2 [Gorilla gorilla gorilla] |