Gene/Proteome Database (LMPD)
Proteins
| G-protein coupled receptor 6 | |
|---|---|
| Refseq ID | NP_951013 |
| Protein GI | 39979620 |
| UniProt ID | Q6YNI2 |
| mRNA ID | NM_199058 |
| Length | 363 |
| RefSeq Status | PROVISIONAL |
| MNASAAALNESQVVAVAAEGAAAAATAAGAPDTGEWGPPAASAALGGGGGPNGSLELSSQLPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPALRTPMFVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAITVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRTSCSVVRPLTRSHVALLSTSFFVVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGTLAVVLGTFGASWLPFAIYCVVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRALWLLFCGCFQSKVPFRSRSPSEV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0038036 | IDA:MGI | F | sphingosine-1-phosphate receptor activity |
| GO:0007204 | IDA:MGI | P | positive regulation of cytosolic calcium ion concentration |
| GO:0003376 | IDA:GOC | P | sphingosine-1-phosphate signaling pathway |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Caution | Was originally (PubMed:14592418) thought to be a receptor for sphingosine 1-phosphate. It has been demonstrated that it is not the case in human. {ECO:0000305|PubMed:14592418}. |
| Disruption Phenotype | Deficient mice show reduced striatal cyclic AMP production and selective alterations in instrumental conditioning. {ECO:0000269|PubMed:17934457}. |
| Function | Orphan receptor with constitutive G(s) signaling activity that activate cyclic AMP. Promotes neurite outgrowth and blocks myelin inhibition in neurons (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the G-protein coupled receptor 1 family. {ECO:0000255|PROSITE-ProRule:PRU00521}. |
| Subcellular Location | Cell membrane {ECO:0000305|PubMed:17284443}; Multi-pass membrane protein {ECO:0000305|PubMed:17284443}. Note=Highly expressed and localized along the cytoplasmic membrane as well as in a perinuclear compartment. |
| Tissue Specificity | Mainly expressed in the brain. Selectively expressed in striatopallidal neurons in the striatum. {ECO:0000269|PubMed:17284443, ECO:0000269|PubMed:17934457}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001735 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 39979620 | RefSeq | NP_951013 | 363 | G-protein coupled receptor 6 |
Identical Sequences to LMP001735 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:39979620 | DBBJ | BAE23977.1 | 363 | unnamed protein product [Mus musculus] |
| GI:39979620 | GenBank | EDL04965.1 | 363 | mCG1028770 [Mus musculus] |
| GI:39979620 | GenBank | AAI52949.1 | 363 | G protein-coupled receptor 6, partial [synthetic construct] |
| GI:39979620 | GenBank | AFO06860.1 | 363 | Sequence 49 from patent US 8221990 |
| GI:39979620 | RefSeq | XP_006512596.1 | 363 | PREDICTED: G-protein coupled receptor 6 isoform X1 [Mus musculus] |
| GI:39979620 | SwissProt | Q6YNI2.1 | 363 | RecName: Full=G-protein coupled receptor 6; AltName: Full=Sphingosine 1-phosphate receptor GPR6 [Mus musculus] |
Related Sequences to LMP001735 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:39979620 | GenBank | AAA21870.1 | 363 | putative G protein-coupled receptor [Rattus norvegicus] |
| GI:39979620 | GenBank | AAC16886.1 | 363 | putative G protein-coupled receptor [Rattus norvegicus] |
| GI:39979620 | GenBank | AAI11862.1 | 359 | Gpr6 protein, partial [Mus musculus] |
| GI:39979620 | GenBank | EDL83244.1 | 363 | G protein-coupled receptor 6 [Rattus norvegicus] |
| GI:39979620 | RefSeq | NP_113994.1 | 363 | G-protein coupled receptor 6 [Rattus norvegicus] |
| GI:39979620 | SwissProt | P51651.1 | 363 | RecName: Full=G-protein coupled receptor 6; AltName: Full=Sphingosine 1-phosphate receptor GPR6 [Rattus norvegicus] |