Gene/Proteome Database (LMPD)
LMPD ID
LMP001754
Gene ID
Species
Homo sapiens (Human)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Gene Symbol
Synonyms
SIAT10; ST3GALVI
Alternate Names
type 2 lactosamine alpha-2,3-sialyltransferase; alpha2,3-sialyltransferase ST3Gal VI; sialyltransferase 10 (alpha-2,3-sialyltransferase VI); CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI
Chromosome
3
Map Location
3q12.1
EC Number
2.4.99.-
Summary
The protein encoded by this gene is a member of the sialyltransferase family. Members of this family are enzymes that transfer sialic acid from the activated cytidine 5'-monophospho-N-acetylneuraminic acid to terminal positions on sialylated glycolipids (gangliosides) or to the N- or O-linked sugar chains of glycoproteins. This protein has high specificity for neolactotetraosylceramide and neolactohexaosylceramide as glycolipid substrates and may contribute to the formation of selectin ligands and sialyl Lewis X, a carbohydrate important for cell-to-cell recognition and a blood group antigen. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Sep 2012]
Orthologs
Proteins
| type 2 lactosamine alpha-2,3-sialyltransferase isoform 1 | |
|---|---|
| Refseq ID | NP_001258075 |
| Protein GI | 403225034 |
| UniProt ID | Q9Y274 |
| mRNA ID | NM_001271146 |
| Length | 331 |
| RefSeq Status | REVIEWED |
| MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD | |
| type 2 lactosamine alpha-2,3-sialyltransferase isoform 1 | |
|---|---|
| Refseq ID | NP_006091 |
| Protein GI | 5174697 |
| UniProt ID | Q9Y274 |
| mRNA ID | NM_006100 |
| Length | 331 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:403225034 (mRNA isoform) | |
| type 2 lactosamine alpha-2,3-sialyltransferase isoform 3 | |
|---|---|
| Refseq ID | NP_001258074 |
| Protein GI | 403225032 |
| UniProt ID | Q9Y274 |
| mRNA ID | NM_001271145 |
| Length | 384 |
| RefSeq Status | REVIEWED |
| MWQAPRERQQPAGAAAPQVSEPGAPLRSSLLGLGGSLLPAGFAAGLHCPGEPAMRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD | |
| type 2 lactosamine alpha-2,3-sialyltransferase isoform 4 | |
|---|---|
| Refseq ID | NP_001258076 |
| Protein GI | 403225036 |
| UniProt ID | Q9Y274 |
| mRNA ID | NM_001271147 |
| Length | 213 |
| RefSeq Status | REVIEWED |
| MRTSAEYFRLALSKLQSCDLFDEFDKMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD | |
Gene Information
Entrez Gene ID
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000139 | TAS:Reactome | C | Golgi membrane |
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0030173 | IEA:InterPro | C | integral component of Golgi membrane |
| GO:0016021 | NAS:UniProtKB | C | integral component of membrane |
| GO:0052798 | IDA:UniProtKB | F | beta-galactoside alpha-2,3-sialyltransferase activity |
| GO:0005975 | TAS:Reactome | P | carbohydrate metabolic process |
| GO:0006464 | IDA:UniProtKB | P | cellular protein modification process |
| GO:0071354 | IEP:UniProtKB | P | cellular response to interleukin-6 |
| GO:0006664 | IDA:UniProtKB | P | glycolipid metabolic process |
| GO:0030203 | TAS:Reactome | P | glycosaminoglycan metabolic process |
| GO:0018146 | TAS:Reactome | P | keratan sulfate biosynthetic process |
| GO:0042339 | TAS:Reactome | P | keratan sulfate metabolic process |
| GO:0009311 | IDA:UniProtKB | P | oligosaccharide metabolic process |
| GO:0006486 | IEA:InterPro | P | protein glycosylation |
| GO:0097503 | IDA:GOC | P | sialylation |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_121120 | Keratan sulfate biosynthesis |
| REACT_121288 | Keratan sulfate/keratin metabolism |
| REACT_118798 | Pre-NOTCH Processing in Golgi |
| REACT_200874 | Sialic acid metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Protein Entry
SIA10_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y274-1; Sequence=Displayed; Name=2; IsoId=Q9Y274-2; Sequence=VSP_047009, VSP_047010; |
| Function | Involved in the synthesis of sialyl-paragloboside, a precursor of sialyl-Lewis X determinant. Has a alpha-2,3- sialyltransferase activity toward Gal-beta1,4-GlcNAc structure on glycoproteins and glycolipids. Has a restricted substrate specificity, it utilizes Gal-beta1,4-GlcNAc on glycoproteins, and neolactotetraosylceramide and neolactohexaosylceramide, but not lactotetraosylceramide, lactosylceramide or asialo-GM1. |
| Similarity | Belongs to the glycosyltransferase 29 family. |
| Subcellular Location | Golgi apparatus membrane ; Single-pass type II membrane protein . |
| Tissue Specificity | Ubiquitous. |
| Web Resource | Name=Functional Glycomics Gateway - GTase; Note=ST3Gal VI; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_627"; |
| Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST3GAL6"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP001754 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 403225034 | RefSeq | NP_001258075 | 331 | type 2 lactosamine alpha-2,3-sialyltransferase isoform 1 |
| 403225032 | RefSeq | NP_001258074 | 384 | type 2 lactosamine alpha-2,3-sialyltransferase isoform 3 |
| 403225036 | RefSeq | NP_001258076 | 213 | type 2 lactosamine alpha-2,3-sialyltransferase isoform 4 |
Identical Sequences to LMP001754 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:403225032 | GenBank | AAE80034.1 | 384 | Sequence 8 from patent US 6280989 |
| GI:403225032 | GenBank | EAW79851.1 | 384 | ST3 beta-galactoside alpha-2,3-sialyltransferase 6, isoform CRA_b [Homo sapiens] |
| GI:403225036 | RefSeq | XP_005548388.1 | 213 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X8 [Macaca fascicularis] |
| GI:403225034 | RefSeq | XP_009197206.1 | 331 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X3 [Papio anubis] |
| GI:403225034 | RefSeq | XP_009197208.1 | 331 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X3 [Papio anubis] |
| GI:403225034 | RefSeq | XP_009236925.1 | 331 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Pongo abelii] |
| GI:403225034 | RefSeq | XP_009236926.1 | 331 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Pongo abelii] |
| GI:403225034 | RefSeq | XP_009236927.1 | 331 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Pongo abelii] |
| GI:403225034 | RefSeq | XP_009236928.1 | 331 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Pongo abelii] |
Related Sequences to LMP001754 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:403225036 | DBBJ | BAG50993.1 | 213 | unnamed protein product [Homo sapiens] |
| GI:403225034 | GenBank | AAE80034.1 | 384 | Sequence 8 from patent US 6280989 |
| GI:403225034 | GenBank | EAW79851.1 | 384 | ST3 beta-galactoside alpha-2,3-sialyltransferase 6, isoform CRA_b [Homo sapiens] |
| GI:403225032 | RefSeq | XP_001089053.2 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform 1 [Macaca mulatta] |
| GI:403225034 | RefSeq | XP_001089053.2 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform 1 [Macaca mulatta] |
| GI:403225032 | RefSeq | XP_003893899.1 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Papio anubis] |
| GI:403225034 | RefSeq | XP_003893899.1 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Papio anubis] |
| GI:403225034 | RefSeq | NP_001258074.1 | 384 | type 2 lactosamine alpha-2,3-sialyltransferase isoform 3 [Homo sapiens] |
| GI:403225036 | RefSeq | XP_004036013.1 | 213 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform 3 [Gorilla gorilla gorilla] |
| GI:403225034 | RefSeq | XP_005247124.1 | 354 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Homo sapiens] |
| GI:403225036 | RefSeq | XP_006713537.1 | 352 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X7 [Homo sapiens] |
| GI:403225036 | RefSeq | XP_006713539.1 | 299 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X9 [Homo sapiens] |
| GI:403225032 | RefSeq | XP_007984270.1 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Chlorocebus sabaeus] |
| GI:403225032 | RefSeq | XP_007984271.1 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Chlorocebus sabaeus] |
| GI:403225032 | RefSeq | XP_010352023.1 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Rhinopithecus roxellana] |
| GI:403225032 | RefSeq | XP_010352024.1 | 392 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Rhinopithecus roxellana] |
| GI:403225036 | RefSeq | XP_010352025.1 | 360 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X2 [Rhinopithecus roxellana] |
| GI:403225036 | RefSeq | XP_010352028.1 | 299 | PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X5 [Rhinopithecus roxellana] |