Gene/Proteome Database (LMPD)

LMPD ID
LMP001754
Gene ID
10402
Species
Homo sapiens (Human)
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Gene Symbol
ST3GAL6
Synonyms
SIAT10; ST3GALVI
Alternate Names
type 2 lactosamine alpha-2,3-sialyltransferase; alpha2,3-sialyltransferase ST3Gal VI; sialyltransferase 10 (alpha-2,3-sialyltransferase VI); CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI
Chromosome
3
Map Location
3q12.1
EC Number
2.4.99.-
Summary
The protein encoded by this gene is a member of the sialyltransferase family. Members of this family are enzymes that transfer sialic acid from the activated cytidine 5'-monophospho-N-acetylneuraminic acid to terminal positions on sialylated glycolipids (gangliosides) or to the N- or O-linked sugar chains of glycoproteins. This protein has high specificity for neolactotetraosylceramide and neolactohexaosylceramide as glycolipid substrates and may contribute to the formation of selectin ligands and sialyl Lewis X, a carbohydrate important for cell-to-cell recognition and a blood group antigen. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Sep 2012]
Orthologs
View orthologs and multiple alignments for ST3GAL6

Proteins

type 2 lactosamine alpha-2,3-sialyltransferase isoform 1
Refseq ID NP_001258075
Protein GI 403225034
UniProt ID Q9Y274
mRNA ID NM_001271146
Length 331
RefSeq Status REVIEWED
MRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD
type 2 lactosamine alpha-2,3-sialyltransferase isoform 1
Refseq ID NP_006091
Protein GI 5174697
UniProt ID Q9Y274
mRNA ID NM_006100
Length 331
RefSeq Status REVIEWED
Protein sequence is identical to GI:403225034 (mRNA isoform)
type 2 lactosamine alpha-2,3-sialyltransferase isoform 3
Refseq ID NP_001258074
Protein GI 403225032
UniProt ID Q9Y274
mRNA ID NM_001271145
Length 384
RefSeq Status REVIEWED
MWQAPRERQQPAGAAAPQVSEPGAPLRSSLLGLGGSLLPAGFAAGLHCPGEPAMRGYLVAIFLSAVFLYYVLHCILWGTNVYWVAPVEMKRRNKIQPCLSKPAFASLLRFHQFHPFLCAADFRKIASLYGSDKFDLPYGMRTSAEYFRLALSKLQSCDLFDEFDNIPCKKCVVVGNGGVLKNKTLGEKIDSYDVIIRMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD
type 2 lactosamine alpha-2,3-sialyltransferase isoform 4
Refseq ID NP_001258076
Protein GI 403225036
UniProt ID Q9Y274
mRNA ID NM_001271147
Length 213
RefSeq Status REVIEWED
MRTSAEYFRLALSKLQSCDLFDEFDKMNNGPVLGHEEEVGRRTTFRLFYPESVFSDPIHNDPNTTVILTAFKPHDLRWLLELLMGDKINTNGFWKKPALNLIYKPYQIRILDPFIIRTAAYELLHFPKVFPKNQKPKHPTTGIIAITLAFYICHEVHLAGFKYNFSDLKSPLHYYGNATMSLMNKNAYHNVTAEQLFLKDIIEKNLVINLTQD

Gene Information

Entrez Gene ID
10402
Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Gene Symbol
ST3GAL6
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 TAS:Reactome C Golgi membrane
GO:0070062 IDA:UniProtKB C extracellular vesicular exosome
GO:0030173 IEA:InterPro C integral component of Golgi membrane
GO:0016021 NAS:UniProtKB C integral component of membrane
GO:0052798 IDA:UniProtKB F beta-galactoside alpha-2,3-sialyltransferase activity
GO:0005975 TAS:Reactome P carbohydrate metabolic process
GO:0006464 IDA:UniProtKB P cellular protein modification process
GO:0071354 IEP:UniProtKB P cellular response to interleukin-6
GO:0006664 IDA:UniProtKB P glycolipid metabolic process
GO:0030203 TAS:Reactome P glycosaminoglycan metabolic process
GO:0018146 TAS:Reactome P keratan sulfate biosynthetic process
GO:0042339 TAS:Reactome P keratan sulfate metabolic process
GO:0009311 IDA:UniProtKB P oligosaccharide metabolic process
GO:0006486 IEA:InterPro P protein glycosylation
GO:0097503 IDA:GOC P sialylation
GO:0044281 TAS:Reactome P small molecule metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_121120 Keratan sulfate biosynthesis
REACT_121288 Keratan sulfate/keratin metabolism
REACT_118798 Pre-NOTCH Processing in Golgi
REACT_200874 Sialic acid metabolism

Domain Information

InterPro Annotations

Accession Description
IPR001675 Glycosyl transferase, family 29
IPR012163 Sialyltransferase

UniProt Annotations

Entry Information

Gene Name
ST3 beta-galactoside alpha-2,3-sialyltransferase 6
Protein Entry
SIA10_HUMAN
UniProt ID
Q9Y274
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y274-1; Sequence=Displayed; Name=2; IsoId=Q9Y274-2; Sequence=VSP_047009, VSP_047010;
Function Involved in the synthesis of sialyl-paragloboside, a precursor of sialyl-Lewis X determinant. Has a alpha-2,3- sialyltransferase activity toward Gal-beta1,4-GlcNAc structure on glycoproteins and glycolipids. Has a restricted substrate specificity, it utilizes Gal-beta1,4-GlcNAc on glycoproteins, and neolactotetraosylceramide and neolactohexaosylceramide, but not lactotetraosylceramide, lactosylceramide or asialo-GM1.
Similarity Belongs to the glycosyltransferase 29 family.
Subcellular Location Golgi apparatus membrane ; Single-pass type II membrane protein .
Tissue Specificity Ubiquitous.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=ST3Gal VI; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_627";
Web Resource Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=ST3GAL6";

Identical and Related Proteins

Unique RefSeq proteins for LMP001754 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
403225034 RefSeq NP_001258075 331 type 2 lactosamine alpha-2,3-sialyltransferase isoform 1
403225032 RefSeq NP_001258074 384 type 2 lactosamine alpha-2,3-sialyltransferase isoform 3
403225036 RefSeq NP_001258076 213 type 2 lactosamine alpha-2,3-sialyltransferase isoform 4

Identical Sequences to LMP001754 proteins

Reference Database Accession Length Protein Name
GI:403225032 GenBank AAE80034.1 384 Sequence 8 from patent US 6280989
GI:403225032 GenBank EAW79851.1 384 ST3 beta-galactoside alpha-2,3-sialyltransferase 6, isoform CRA_b [Homo sapiens]
GI:403225036 RefSeq XP_005548388.1 213 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X8 [Macaca fascicularis]
GI:403225034 RefSeq XP_009197206.1 331 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X3 [Papio anubis]
GI:403225034 RefSeq XP_009197208.1 331 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X3 [Papio anubis]
GI:403225034 RefSeq XP_009236925.1 331 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Pongo abelii]
GI:403225034 RefSeq XP_009236926.1 331 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Pongo abelii]
GI:403225034 RefSeq XP_009236927.1 331 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Pongo abelii]
GI:403225034 RefSeq XP_009236928.1 331 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Pongo abelii]

Related Sequences to LMP001754 proteins

Reference Database Accession Length Protein Name
GI:403225036 DBBJ BAG50993.1 213 unnamed protein product [Homo sapiens]
GI:403225034 GenBank AAE80034.1 384 Sequence 8 from patent US 6280989
GI:403225034 GenBank EAW79851.1 384 ST3 beta-galactoside alpha-2,3-sialyltransferase 6, isoform CRA_b [Homo sapiens]
GI:403225032 RefSeq XP_001089053.2 392 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform 1 [Macaca mulatta]
GI:403225034 RefSeq XP_001089053.2 392 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform 1 [Macaca mulatta]
GI:403225032 RefSeq XP_003893899.1 392 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Papio anubis]
GI:403225034 RefSeq XP_003893899.1 392 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Papio anubis]
GI:403225034 RefSeq NP_001258074.1 384 type 2 lactosamine alpha-2,3-sialyltransferase isoform 3 [Homo sapiens]
GI:403225036 RefSeq XP_004036013.1 213 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform 3 [Gorilla gorilla gorilla]
GI:403225034 RefSeq XP_005247124.1 354 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Homo sapiens]
GI:403225036 RefSeq XP_006713537.1 352 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X7 [Homo sapiens]
GI:403225036 RefSeq XP_006713539.1 299 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X9 [Homo sapiens]
GI:403225032 RefSeq XP_007984270.1 392 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Chlorocebus sabaeus]
GI:403225032 RefSeq XP_007984271.1 392 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Chlorocebus sabaeus]
GI:403225032 RefSeq XP_010352023.1 392 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Rhinopithecus roxellana]
GI:403225032 RefSeq XP_010352024.1 392 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X1 [Rhinopithecus roxellana]
GI:403225036 RefSeq XP_010352025.1 360 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X2 [Rhinopithecus roxellana]
GI:403225036 RefSeq XP_010352028.1 299 PREDICTED: type 2 lactosamine alpha-2,3-sialyltransferase isoform X5 [Rhinopithecus roxellana]