Gene/Proteome Database (LMPD)
LMPD ID
LMP001759
Gene ID
Species
Mus musculus (Mouse)
Gene Name
3-ketodihydrosphingosine reductase
Gene Symbol
Synonyms
6330410P18Rik; 9430079B08Rik; Fvt1
Alternate Names
3-ketodihydrosphingosine reductase; FVT-1; KDS reductase; 3-dehydrosphinganine reductase; follicular lymphoma variant translocation 1; follicular variant translocation protein 1 homolog
Chromosome
1
Map Location
1 E2.1|1
EC Number
1.1.1.102
Proteins
| 3-ketodihydrosphingosine reductase precursor | |
|---|---|
| Refseq ID | NP_081810 |
| Protein GI | 110625780 |
| UniProt ID | Q6GV12 |
| mRNA ID | NM_027534 |
| Length | 332 |
| RefSeq Status | VALIDATED |
| MLLLAAAGLVAFVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKDIEKHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFEELEVSSFEKLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKPLETRLISETTAICKPEQVAKQIVKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDNIVRRCMVQKAKPEVVDKTA | |
| sig_peptide: 1..25 inference: non-experimental evidence, no additional details recorded note: Potential; propagated from UniProtKB/Swiss-Prot (Q6GV12.1) calculated_mol_wt: 2616 peptide sequence: MLLLAAAGLVAFVLLLYMVSPLISP mat_peptide: 26..332 product: 3-ketodihydrosphingosine reductase experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q6GV12.1) calculated_mol_wt: 33358 peptide sequence: KPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKDIEKHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGTSMSGKFEELEVSSFEKLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSSSKFAIRGLAEALQMEVKPYNVYVTVAYPPDTDTPGLAEENKTKPLETRLISETTAICKPEQVAKQIVKDAIQGNFNSSIGSDGYMLSSLTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDNIVRRCMVQKAKPEVVDKTA | |
Gene Information
Entrez Gene ID
Gene Name
3-ketodihydrosphingosine reductase
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | ISO:MGI | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0047560 | ISO:MGI | F | 3-dehydrosphinganine reductase activity |
| GO:0006666 | ISO:MGI | P | 3-keto-sphinganine metabolic process |
| GO:0030148 | IGI:MGI | P | sphingolipid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| mmu00600 | Sphingolipid metabolism |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY3DJ-12 | ceramide biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
3-ketodihydrosphingosine reductase
Protein Entry
KDSR_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Sphinganine + NADP(+) = 3-dehydrosphinganine + NADPH. |
| Function | Catalyzes the reduction of 3-ketodihydrosphingosine (KDS) to dihydrosphingosine (DHS). {ECO:0000269|PubMed:15328338}. |
| Pathway | Lipid metabolism; sphingolipid metabolism. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001759 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 110625780 | RefSeq | NP_081810 | 332 | 3-ketodihydrosphingosine reductase precursor |
Identical Sequences to LMP001759 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:110625780 | GenBank | AAT57900.1 | 332 | follicular lymphoma variant translocation 1 [Mus musculus] |
| GI:110625780 | GenBank | AAH23820.2 | 332 | 3-ketodihydrosphingosine reductase [Mus musculus] |
| GI:110625780 | GenBank | EDL39860.1 | 332 | mCG8996, isoform CRA_b [Mus musculus] |
| GI:110625780 | SwissProt | Q6GV12.1 | 332 | RecName: Full=3-ketodihydrosphingosine reductase; Short=KDS reductase; AltName: Full=3-dehydrosphinganine reductase; AltName: Full=Follicular variant translocation protein 1 homolog; Short=FVT-1; Flags: Precursor [Mus musculus] |
Related Sequences to LMP001759 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:110625780 | GenBank | EDL91747.1 | 332 | follicular lymphoma variant translocation 1 (predicted), isoform CRA_a [Rattus norvegicus] |
| GI:110625780 | RefSeq | NP_001101812.1 | 332 | 3-ketodihydrosphingosine reductase [Rattus norvegicus] |
| GI:110625780 | RefSeq | XP_005348350.1 | 332 | PREDICTED: 3-ketodihydrosphingosine reductase [Microtus ochrogaster] |
| GI:110625780 | RefSeq | XP_006993749.1 | 332 | PREDICTED: 3-ketodihydrosphingosine reductase [Peromyscus maniculatus bairdii] |
| GI:110625780 | RefSeq | XP_008838877.1 | 332 | PREDICTED: 3-ketodihydrosphingosine reductase [Nannospalax galili] |
| GI:110625780 | RefSeq | XP_008838878.1 | 332 | PREDICTED: 3-ketodihydrosphingosine reductase [Nannospalax galili] |