Gene/Proteome Database (LMPD)
LMPD ID
LMP001771
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidic acid phosphatase type 2C
Gene Symbol
Synonyms
Lpp2; PAP2-G; PAP2-gamma; PAP2c
Alternate Names
lipid phosphate phosphohydrolase 2; phosphatidic acid phosphatase 2c; phosphatidate phosphohydrolase type 2c
Chromosome
10
Map Location
10 C1|10 39.72 cM
EC Number
3.1.3.4
Summary
The protein encoded by this gene is a lipid phosphate phosphohydrolase. It is an integral membrane protein that catalyzes the conversion of phosphatidic acid to diacylglycerol and inorganic phosphate. The transcript is expressed at high levels in lung, liver, and kidney and at low levels in brain and heart. Null mutant mice are viable and fertile and display no overt phenotypic defects. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
Orthologs
Proteins
| lipid phosphate phosphohydrolase 2 isoform 1 | |
|---|---|
| Refseq ID | NP_056632 |
| Protein GI | 110431341 |
| UniProt ID | Q9DAX2 |
| mRNA ID | NM_015817 |
| Length | 276 |
| RefSeq Status | REVIEWED |
| MERRWVFVLLDVLCVLVASLPFIILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGVIITATVILVSLGEAYLVYTDRLYSRSNFNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPSFLAVCDPDWSQVNCSGYVQLEVCRGSPANVTEARLSFYSGHSSFGMYCMLFLALYVQARLCWKWARLLRPTVQFFLVAFAIYVGYTRVSDHKHHWSDVLVGLLQGALVACLTVRYVSDFFKSRPPQPCQEDEVPERKPSLSLTLTLGDRP | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidic acid phosphatase type 2C
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008195 | ISS:MGI | F | phosphatidate phosphatase activity |
| GO:0016311 | ISS:GOC | P | dephosphorylation |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidic acid phosphatase type 2C
Protein Entry
LPP2_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9DAX2-1; Sequence=Displayed; Name=2; IsoId=Q9DAX2-2; Sequence=VSP_009654, VSP_009655; |
| Catalytic Activity | A 1,2-diacylglycerol 3-phosphate + H(2)O = a 1,2-diacyl-sn-glycerol + phosphate. |
| Function | Catalyzes the conversion of phosphatidic acid (PA) to diacylglycerol (DG). In addition it hydrolyzes lysophosphatidic acid (LPA), ceramide-1-phosphate (C-1-P) and sphingosine-1- phosphate (S-1-P) (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the PA-phosphatase related phosphoesterase family. {ECO:0000305}. |
| Subcellular Location | Membrane; Multi-pass membrane protein. |
| Subunit | Homodimer. {ECO:0000250}. |
| Tissue Specificity | Expressed at high levels in lung, liver and kidney; at low levels in heart and brain, and was not detected in skeletal muscle. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001771 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 110431341 | RefSeq | NP_056632 | 276 | lipid phosphate phosphohydrolase 2 isoform 1 |
Identical Sequences to LMP001771 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:110431341 | DBBJ | BAB24045.1 | 276 | unnamed protein product [Mus musculus] |
| GI:110431341 | DBBJ | BAC33824.1 | 276 | unnamed protein product [Mus musculus] |
| GI:110431341 | GenBank | AAH10332.1 | 276 | Phosphatidic acid phosphatase type 2C [Mus musculus] |
| GI:110431341 | GenBank | EDL31697.1 | 276 | phosphatidic acid phosphatase type 2c, isoform CRA_c [Mus musculus] |
| GI:110431341 | GenBank | EDL31698.1 | 276 | phosphatidic acid phosphatase type 2c, isoform CRA_c [Mus musculus] |
| GI:110431341 | SwissProt | Q9DAX2.1 | 276 | RecName: Full=Lipid phosphate phosphohydrolase 2; AltName: Full=PAP2-gamma; Short=PAP2-G; AltName: Full=Phosphatidate phosphohydrolase type 2c; AltName: Full=Phosphatidic acid phosphatase 2c; Short=PAP-2c; Short=PAP2c [Mus musculus] |
Related Sequences to LMP001771 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:110431341 | GenBank | AAM28632.1 | 276 | lipid phosphate phosphohydrolase 2 [Rattus norvegicus] |
| GI:110431341 | GenBank | EGV99452.1 | 276 | Lipid phosphate phosphohydrolase 2 [Cricetulus griseus] |
| GI:110431341 | RefSeq | XP_005359177.1 | 305 | PREDICTED: LOW QUALITY PROTEIN: lipid phosphate phosphohydrolase 2 [Microtus ochrogaster] |
| GI:110431341 | RefSeq | XP_006978302.1 | 276 | PREDICTED: lipid phosphate phosphohydrolase 2 [Peromyscus maniculatus bairdii] |
| GI:110431341 | RefSeq | XP_003502642.2 | 276 | PREDICTED: lipid phosphate phosphohydrolase 2 isoform X1 [Cricetulus griseus] |
| GI:110431341 | RefSeq | XP_007614994.1 | 276 | PREDICTED: lipid phosphate phosphohydrolase 2 isoform X1 [Cricetulus griseus] |