Gene/Proteome Database (LMPD)
LMPD ID
LMP001829
Gene ID
Species
Homo sapiens (Human)
Gene Name
enoyl CoA hydratase, short chain, 1, mitochondrial
Gene Symbol
Synonyms
SCEH
Alternate Names
enoyl-CoA hydratase, mitochondrial; enoyl-CoA hydratase 1; short-chain enoyl-CoA hydratase; enoyl Coenzyme A hydratase, short chain, 1, mitochondrial
Chromosome
10
Map Location
10q26.2-q26.3
EC Number
4.2.1.17
Summary
The protein encoded by this gene functions in the second step of the mitochondrial fatty acid beta-oxidation pathway. It catalyzes the hydration of 2-trans-enoyl-coenzyme A (CoA) intermediates to L-3-hydroxyacyl-CoAs. The gene product is a member of the hydratase/isomerase superfamily. It localizes to the mitochondrial matrix. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| enoyl-CoA hydratase, mitochondrial | |
|---|---|
| Refseq ID | NP_004083 |
| Protein GI | 194097323 |
| UniProt ID | P30084 |
| mRNA ID | NM_004092 |
| Length | 290 |
| RefSeq Status | REVIEWED |
| MAALRVLLSCVRGPLRPPVRCPAWRPFASGANFEYIIAEKRGKNNTVGLIQLNRPKALNALCDGLIDELNQALKTFEEDPAVGAIVLTGGDKAFAAGADIKEMQNLSFQDCYSSKFLKHWDHLTQVKKPVIAAVNGYAFGGGCELAMMCDIIYAGEKAQFAQPEILIGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKICPVETLVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGSKLEKKLFYSTFATDDRKEGMTAFVEKRKANFKDQ | |
Gene Information
Entrez Gene ID
Gene Name
enoyl CoA hydratase, short chain, 1, mitochondrial
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0005759 | TAS:Reactome | C | mitochondrial matrix |
| GO:0005739 | TAS:UniProtKB | C | mitochondrion |
| GO:0004300 | TAS:Reactome | F | enoyl-CoA hydratase activity |
| GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
| GO:0006635 | TAS:Reactome | P | fatty acid beta-oxidation |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa01200 | Carbon metabolism |
Domain Information
UniProt Annotations
Entry Information
Gene Name
enoyl CoA hydratase, short chain, 1, mitochondrial
Protein Entry
ECHM_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl- CoA + H(2)O. |
| Function | Straight-chain enoyl-CoA thioesters from C4 up to at least C16 are processed, although with decreasing catalytic rate. |
| Interaction | Q5S007:LRRK2; NbExp=2; IntAct=EBI-719602, EBI-5323863; P40763:STAT3; NbExp=3; IntAct=EBI-719602, EBI-518675; P42227:Stat3 (xeno); NbExp=3; IntAct=EBI-719602, EBI-602878; |
| Pathway | Lipid metabolism; fatty acid beta-oxidation. |
| Similarity | Belongs to the enoyl-CoA hydratase/isomerase family. |
| Subcellular Location | Mitochondrion matrix. |
| Subunit | Homohexamer; dimer of trimers. |
| Tissue Specificity | Liver, fibroblast, muscle. Barely detectable in spleen and kidney. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001829 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 194097323 | RefSeq | NP_004083 | 290 | enoyl-CoA hydratase, mitochondrial |
Identical Sequences to LMP001829 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:194097323 | SwissProt | P30084.4 | 290 | RecName: Full=Enoyl-CoA hydratase, mitochondrial; AltName: Full=Enoyl-CoA hydratase 1; AltName: Full=Short-chain enoyl-CoA hydratase; Short=SCEH; Flags: Precursor [Homo sapiens] |
Related Sequences to LMP001829 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:194097323 | GenBank | AAH08906.1 | 290 | Enoyl Coenzyme A hydratase, short chain, 1, mitochondrial [Homo sapiens] |
| GI:194097323 | GenBank | AAX32540.1 | 290 | mitochondrial enoyl coenzyme A hydratase short chain 1 [synthetic construct] |
| GI:194097323 | GenBank | AAX32541.1 | 290 | mitochondrial enoyl coenzyme A hydratase short chain 1 [synthetic construct] |
| GI:194097323 | GenBank | EAW61339.1 | 290 | enoyl Coenzyme A hydratase, short chain, 1, mitochondrial [Homo sapiens] |
| GI:194097323 | GenBank | ADT51564.1 | 290 | Sequence 3581 from patent US 7842467 |
| GI:194097323 | GenBank | AIC54316.1 | 290 | ECHS1, partial [synthetic construct] |