Gene/Proteome Database (LMPD)
LMPD ID
LMP001885
Gene ID
Species
Homo sapiens (Human)
Gene Name
aldo-keto reductase family 1, member B1 (aldose reductase)
Gene Symbol
Synonyms
ADR; ALDR1; ALR2; AR
Alternate Names
aldose reductase; aldehyde reductase 1; low Km aldose reductase; Lii5-2 CTCL tumor antigen; aldo-keto reductase family 1 member B1
Chromosome
7
Map Location
7q35
EC Number
1.1.1.21
Summary
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. [provided by RefSeq, Feb 2009]
Orthologs
Proteins
| aldose reductase | |
|---|---|
| Refseq ID | NP_001619 |
| Protein GI | 4502049 |
| UniProt ID | P15121 |
| mRNA ID | NM_001628 |
| Length | 316 |
| RefSeq Status | REVIEWED |
| MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF | |
Gene Information
Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member B1 (aldose reductase)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:HPA | C | cytoplasm |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0005615 | TAS:ProtInc | C | extracellular space |
| GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
| GO:0005634 | IDA:HPA | C | nucleus |
| GO:0004032 | TAS:ProtInc | F | alditol:NADP+ 1-oxidoreductase activity |
| GO:0004033 | TAS:UniProtKB | F | aldo-keto reductase (NADP) activity |
| GO:0009055 | TAS:UniProtKB | F | electron carrier activity |
| GO:0043795 | IDA:UniProtKB | F | glyceraldehyde oxidoreductase activity |
| GO:0006700 | TAS:Reactome | P | C21-steroid hormone biosynthetic process |
| GO:0005975 | TAS:ProtInc | P | carbohydrate metabolic process |
| GO:0044597 | IMP:UniProtKB | P | daunorubicin metabolic process |
| GO:0044598 | IMP:UniProtKB | P | doxorubicin metabolic process |
| GO:0006950 | TAS:UniProtKB | P | response to stress |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0008202 | TAS:Reactome | P | steroid metabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-5451 | acetone degradation I (to methylglyoxal) |
| PWY-5453 | methylglyoxal degradation III |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_11038 | Pregnenolone biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
aldo-keto reductase family 1, member B1 (aldose reductase)
Protein Entry
ALDR_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Alditol + NAD(P)(+) = aldose + NAD(P)H. |
| Enzyme Regulation | Cys-299 may regulate the kinetic and inhibition properties of the enzyme, but does not participate in catalysis. |
| Function | Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies. |
| Similarity | Belongs to the aldo/keto reductase family. |
| Subcellular Location | Cytoplasm. |
| Subunit | Monomer. {ECO |
| Tissue Specificity | Highly expressed in embryonic epithelial cells (EUE) in response to osmotic stress. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001885 (as displayed in Record Overview)
Identical Sequences to LMP001885 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502049 | GenBank | AEF63931.1 | 316 | Sequence 227 from patent US 7932031 |
| GI:4502049 | GenBank | AEN34898.1 | 316 | Sequence 826 from patent US 7998689 |
| GI:4502049 | GenBank | AEN34900.1 | 316 | Sequence 828 from patent US 7998689 |
| GI:4502049 | GenBank | AHE00454.1 | 316 | Sequence 52880 from patent US 8586006 |
| GI:4502049 | GenBank | AIC48252.1 | 316 | AKR1B1, partial [synthetic construct] |
| GI:4502049 | PDB | 4JIR | 316 | Chain A, Crystal Structure Of Aldose Reductase (akr1b1) Complexed With Nadp+ And Epalrestat |
Related Sequences to LMP001885 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502049 | GenBank | AAX36799.1 | 317 | aldo-keto reductase family 1 member B1, partial [synthetic construct] |
| GI:4502049 | GenBank | AAX43152.1 | 317 | aldo-keto reductase family 1 member B1, partial [synthetic construct] |
| GI:4502049 | PDB | 2I16 | 316 | Chain A, Human Aldose Reductase In Complex With Nadp+ And The Inhibitor Idd594 At Temperature Of 15k |
| GI:4502049 | PDB | 2PDG | 316 | Chain A, Human Aldose Reductase With Uracil-Type Inhibitor At 1.42a. |
| GI:4502049 | PDB | 3BCJ | 316 | Chain A, Crystal Structure Of Aldose Reductase Complexed With 2s4r (Stereoisomer Of Fidarestat, 2s4s) At 0.78 A |
| GI:4502049 | PDB | 3U2C | 316 | Chain A, Aldose Reductase In Complex With Nsaid-type Inhibitor At 1.0 A Resolution |