Gene/Proteome Database (LMPD)

LMPD ID
LMP001906
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Gene Symbol
Synonyms
-
Alternate Names
phosphatidylinositol-glycan biosynthesis class F protein; PIG-F; phosphatidylinositol glycan, class F
Chromosome
17
Map Location
17 E4-E5|17 56.9 cM

Proteins

phosphatidylinositol-glycan biosynthesis class F protein
Refseq ID NP_032864
Protein GI 6679315
UniProt ID O09101
mRNA ID NM_008838
Length 219
RefSeq Status PROVISIONAL
MKDTDIKRLLYTNLLCVFSIFLSIFIPSFFVDNFSVLEAHLTWLCICSASVTTVNLLSYLVVKPNVSSKRSSLSHKVTRALKCCVCFLMSCFLLHIIFVLYGAPLIELVLETFLFAVVLSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFTGAWLGAFPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN

Gene Information

Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IDA:UniProtKB C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016780 TAS:MGI F phosphotransferase activity, for other substituted phosphate groups
GO:0006506 IDA:UniProtKB P GPI anchor biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5893244 Synthesis of glycosylphosphatidylinositol (GPI)

Domain Information

InterPro Annotations

Accession Description
IPR009580 GPI biosynthesis protein Pig-F

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Protein Entry
PIGF_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Function Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI. {ECO:0000269|PubMed:10781593}.
Pathway Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis.
Similarity Belongs to the PIGF family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000269|PubMed:10781593}; Multi-pass membrane protein {ECO:0000269|PubMed:10781593}.
Subunit Forms a complex with PIGG and PIGO. PIGF is required to stabilize PIGG and PIGO. {ECO:0000269|PubMed:10781593}.

Identical and Related Proteins

Unique RefSeq proteins for LMP001906 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6679315 RefSeq NP_032864 219 phosphatidylinositol-glycan biosynthesis class F protein

Identical Sequences to LMP001906 proteins

Reference Database Accession Length Protein Name
GI:6679315 DBBJ BAA08818.1 219 phosphatidylinositol glycan class F [Mus musculus]
GI:6679315 GenBank EDL38619.1 219 phosphatidylinositol glycan anchor biosynthesis, class F [Mus musculus]
GI:6679315 RefSeq XP_006523894.1 219 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X1 [Mus musculus]
GI:6679315 SwissProt O09101.1 219 RecName: Full=Phosphatidylinositol-glycan biosynthesis class F protein; Short=PIG-F [Mus musculus]

Related Sequences to LMP001906 proteins

Reference Database Accession Length Protein Name
GI:6679315 DBBJ BAE21363.1 219 unnamed protein product [Mus musculus]
GI:6679315 DBBJ BAE42236.1 219 unnamed protein product [Mus musculus]
GI:6679315 GenBank AAH28862.1 219 Phosphatidylinositol glycan anchor biosynthesis, class F [Mus musculus]
GI:6679315 RefSeq XP_003511450.1 219 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X2 [Cricetulus griseus]
GI:6679315 RefSeq XP_006986555.1 219 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein [Peromyscus maniculatus bairdii]
GI:6679315 RefSeq XP_007614786.1 219 PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X2 [Cricetulus griseus]