Gene/Proteome Database (LMPD)
LMPD ID
LMP001906
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Gene Symbol
Synonyms
-
Alternate Names
phosphatidylinositol-glycan biosynthesis class F protein; PIG-F; phosphatidylinositol glycan, class F
Chromosome
17
Map Location
17 E4-E5|17 56.9 cM
Proteins
phosphatidylinositol-glycan biosynthesis class F protein | |
---|---|
Refseq ID | NP_032864 |
Protein GI | 6679315 |
UniProt ID | O09101 |
mRNA ID | NM_008838 |
Length | 219 |
RefSeq Status | PROVISIONAL |
MKDTDIKRLLYTNLLCVFSIFLSIFIPSFFVDNFSVLEAHLTWLCICSASVTTVNLLSYLVVKPNVSSKRSSLSHKVTRALKCCVCFLMSCFLLHIIFVLYGAPLIELVLETFLFAVVLSTFTTVPCLCLLGPNLKAWLRVFSRNGVTSIWENSLQITTISSFTGAWLGAFPIPLDWERPWQVWPISCTLGATFGYVAGLVISPLWIYWNRKQLTYKNN |
Gene Information
Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | IDA:UniProtKB | C | endoplasmic reticulum membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016780 | TAS:MGI | F | phosphotransferase activity, for other substituted phosphate groups |
GO:0006506 | IDA:UniProtKB | P | GPI anchor biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu00563 | Glycosylphosphatidylinositol(GPI)-anchor biosynthesis |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5893244 | Synthesis of glycosylphosphatidylinositol (GPI) |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR009580 | GPI biosynthesis protein Pig-F |
UniProt Annotations
Entry Information
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class F
Protein Entry
PIGF_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Involved in GPI-anchor biosynthesis through the transfer of ethanolamine phosphate to the third mannose of GPI. {ECO:0000269|PubMed:10781593}. |
Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
Similarity | Belongs to the PIGF family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:10781593}; Multi-pass membrane protein {ECO:0000269|PubMed:10781593}. |
Subunit | Forms a complex with PIGG and PIGO. PIGF is required to stabilize PIGG and PIGO. {ECO:0000269|PubMed:10781593}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001906 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6679315 | RefSeq | NP_032864 | 219 | phosphatidylinositol-glycan biosynthesis class F protein |
Identical Sequences to LMP001906 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6679315 | DBBJ | BAA08818.1 | 219 | phosphatidylinositol glycan class F [Mus musculus] |
GI:6679315 | GenBank | EDL38619.1 | 219 | phosphatidylinositol glycan anchor biosynthesis, class F [Mus musculus] |
GI:6679315 | RefSeq | XP_006523894.1 | 219 | PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X1 [Mus musculus] |
GI:6679315 | SwissProt | O09101.1 | 219 | RecName: Full=Phosphatidylinositol-glycan biosynthesis class F protein; Short=PIG-F [Mus musculus] |
Related Sequences to LMP001906 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6679315 | DBBJ | BAE21363.1 | 219 | unnamed protein product [Mus musculus] |
GI:6679315 | DBBJ | BAE42236.1 | 219 | unnamed protein product [Mus musculus] |
GI:6679315 | GenBank | AAH28862.1 | 219 | Phosphatidylinositol glycan anchor biosynthesis, class F [Mus musculus] |
GI:6679315 | RefSeq | XP_003511450.1 | 219 | PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X2 [Cricetulus griseus] |
GI:6679315 | RefSeq | XP_006986555.1 | 219 | PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein [Peromyscus maniculatus bairdii] |
GI:6679315 | RefSeq | XP_007614786.1 | 219 | PREDICTED: phosphatidylinositol-glycan biosynthesis class F protein isoform X2 [Cricetulus griseus] |