Gene/Proteome Database (LMPD)
LMPD ID
LMP001920
Gene ID
Species
Homo sapiens (Human)
Gene Name
StAR-related lipid transfer (START) domain containing 6
Gene Symbol
Synonyms
-
Alternate Names
stAR-related lipid transfer protein 6; START domain containing 6; START domain-containing protein 6
Chromosome
18
Map Location
18q21.2
Summary
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD6 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
stAR-related lipid transfer protein 6 | |
---|---|
Refseq ID | NP_631910 |
Protein GI | 21040261 |
UniProt ID | P59095 |
mRNA ID | NM_139171 |
Length | 220 |
RefSeq Status | PROVISIONAL |
MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 6
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
GO:0006869 | IEA:UniProtKB-KW | P | lipid transport |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_111217 | Metabolism |
REACT_22258 | Metabolism of lipids and lipoproteins |
REACT_11057 | Metabolism of steroid hormones and vitamin D |
REACT_11038 | Pregnenolone biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 6
Protein Entry
STAR6_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Function | May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols (By similarity). |
Similarity | Contains 1 START domain. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP001920 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
21040261 | RefSeq | NP_631910 | 220 | stAR-related lipid transfer protein 6 |
Identical Sequences to LMP001920 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:21040261 | DBBJ | BAI46405.1 | 220 | StAR-related lipid transfer (START) domain containing 6, partial [synthetic construct] |
GI:21040261 | GenBank | EAW63004.1 | 220 | START domain containing 6, isoform CRA_c [Homo sapiens] |
GI:21040261 | GenBank | AAI40309.1 | 220 | StAR-related lipid transfer (START) domain containing 6, partial [synthetic construct] |
GI:21040261 | GenBank | AAI46469.1 | 220 | StAR-related lipid transfer (START) domain containing 6 [synthetic construct] |
GI:21040261 | GenBank | AFO06893.1 | 220 | Sequence 25 from patent US 8221999 |
GI:21040261 | PDB | 2MOU | 220 | Chain A, Solution Structure Of Star-related Lipid Transfer Domain Protein 6 (stard6) |
Related Sequences to LMP001920 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:21040261 | RefSeq | XP_523930.2 | 222 | PREDICTED: stAR-related lipid transfer protein 6 isoform X2 [Pan troglodytes] |
GI:21040261 | RefSeq | XP_002828278.1 | 220 | PREDICTED: stAR-related lipid transfer protein 6 [Pongo abelii] |
GI:21040261 | RefSeq | XP_003267572.1 | 220 | PREDICTED: stAR-related lipid transfer protein 6 [Nomascus leucogenys] |
GI:21040261 | RefSeq | XP_003827362.1 | 222 | PREDICTED: stAR-related lipid transfer protein 6 isoform X2 [Pan paniscus] |
GI:21040261 | RefSeq | XP_004059490.1 | 220 | PREDICTED: stAR-related lipid transfer protein 6 [Gorilla gorilla gorilla] |
GI:21040261 | RefSeq | XP_008950861.1 | 233 | PREDICTED: stAR-related lipid transfer protein 6 isoform X1 [Pan paniscus] |