Gene/Proteome Database (LMPD)

LMPD ID
LMP001920
Gene ID
Species
Homo sapiens (Human)
Gene Name
StAR-related lipid transfer (START) domain containing 6
Gene Symbol
Synonyms
-
Alternate Names
stAR-related lipid transfer protein 6; START domain containing 6; START domain-containing protein 6
Chromosome
18
Map Location
18q21.2
Summary
Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD6 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM, Mar 2008]
Orthologs

Proteins

stAR-related lipid transfer protein 6
Refseq ID NP_631910
Protein GI 21040261
UniProt ID P59095
mRNA ID NM_139171
Length 220
RefSeq Status PROVISIONAL
MDFKAIAQQTAQEVLGYNRDTSGWKVVKTSKKITVSSKASRKFHGNLYRVEGIIPESPAKLSDFLYQTGDRITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRYEGNMNIISSKSVDFPEYPPSSNYIRGYNHPCGFVCSPMEENPAYSKLVMFVQTEMRGKLSPSIIEKTMPSNLVNFILNAKDGIKAHRTPSRRGFHHNSHS

Gene Information

Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 6
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0006869 IEA:UniProtKB-KW P lipid transport

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_111217 Metabolism
REACT_22258 Metabolism of lipids and lipoproteins
REACT_11057 Metabolism of steroid hormones and vitamin D
REACT_11038 Pregnenolone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR023393 START-like domain
IPR002913 START_lipid-bd_dom

UniProt Annotations

Entry Information

Gene Name
StAR-related lipid transfer (START) domain containing 6
Protein Entry
STAR6_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Function May be involved in the intracellular transport of sterols or other lipids. May bind cholesterol or other sterols (By similarity).
Similarity Contains 1 START domain. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP001920 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21040261 RefSeq NP_631910 220 stAR-related lipid transfer protein 6

Identical Sequences to LMP001920 proteins

Reference Database Accession Length Protein Name
GI:21040261 DBBJ BAI46405.1 220 StAR-related lipid transfer (START) domain containing 6, partial [synthetic construct]
GI:21040261 GenBank EAW63004.1 220 START domain containing 6, isoform CRA_c [Homo sapiens]
GI:21040261 GenBank AAI40309.1 220 StAR-related lipid transfer (START) domain containing 6, partial [synthetic construct]
GI:21040261 GenBank AAI46469.1 220 StAR-related lipid transfer (START) domain containing 6 [synthetic construct]
GI:21040261 GenBank AFO06893.1 220 Sequence 25 from patent US 8221999
GI:21040261 PDB 2MOU 220 Chain A, Solution Structure Of Star-related Lipid Transfer Domain Protein 6 (stard6)

Related Sequences to LMP001920 proteins

Reference Database Accession Length Protein Name
GI:21040261 RefSeq XP_523930.2 222 PREDICTED: stAR-related lipid transfer protein 6 isoform X2 [Pan troglodytes]
GI:21040261 RefSeq XP_002828278.1 220 PREDICTED: stAR-related lipid transfer protein 6 [Pongo abelii]
GI:21040261 RefSeq XP_003267572.1 220 PREDICTED: stAR-related lipid transfer protein 6 [Nomascus leucogenys]
GI:21040261 RefSeq XP_003827362.1 222 PREDICTED: stAR-related lipid transfer protein 6 isoform X2 [Pan paniscus]
GI:21040261 RefSeq XP_004059490.1 220 PREDICTED: stAR-related lipid transfer protein 6 [Gorilla gorilla gorilla]
GI:21040261 RefSeq XP_008950861.1 233 PREDICTED: stAR-related lipid transfer protein 6 isoform X1 [Pan paniscus]