Gene/Proteome Database (LMPD)
Proteins
| 1-acyl-sn-glycerol-3-phosphate acyltransferase beta precursor | |
|---|---|
| Refseq ID | NP_080488 |
| Protein GI | 23956162 |
| UniProt ID | Q059U0 |
| mRNA ID | NM_026212 |
| Length | 278 |
| RefSeq Status | VALIDATED |
| MDPWPWLTAALLLLLLLVQLSRTARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ | |
| sig_peptide: 1..23 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2664 peptide sequence: MDPWPWLTAALLLLLLLVQLSRT mat_peptide: 24..278 product: 1-acyl-sn-glycerol-3-phosphate acyltransferase beta experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8K3K7.1) calculated_mol_wt: 28364 peptide sequence: ARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ | |
Gene Information
Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016020 | IEA:InterPro | C | membrane |
| GO:0003841 | IEA:InterPro | F | 1-acylglycerol-3-phosphate O-acyltransferase activity |
| GO:0008544 | IEA:Ensembl | P | epidermis development |
| GO:0006654 | IEA:Ensembl | P | phosphatidic acid biosynthetic process |
| GO:0001819 | IEA:Ensembl | P | positive regulation of cytokine production |
Domain Information
UniProt Annotations
Entry Information
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta)
Protein Entry
PLCB_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP001931 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 23956162 | RefSeq | NP_080488 | 278 | 1-acyl-sn-glycerol-3-phosphate acyltransferase beta precursor |
Identical Sequences to LMP001931 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:23956162 | GenBank | AAL62337.1 | 278 | 1-acylglycerol-3-phosphate O-acyltransferase 2 [Mus musculus] |
| GI:23956162 | GenBank | AAI25531.1 | 278 | 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Mus musculus] |
| GI:23956162 | GenBank | EDL08324.1 | 278 | 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta), isoform CRA_a [Mus musculus] |
| GI:23956162 | GenBank | AAI37841.1 | 278 | 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) [Mus musculus] |
| GI:23956162 | SwissProt | Q8K3K7.1 | 278 | RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase beta; AltName: Full=1-acylglycerol-3-phosphate O-acyltransferase 2; Short=1-AGP acyltransferase 2; Short=1-AGPAT 2; AltName: Full=Lysophosphatidic acid acyltransferase beta; Short=LPAAT-beta; Flags: Precursor [Mus musculus] |
Related Sequences to LMP001931 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:23956162 | GenBank | EDL93482.1 | 278 | 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta) (predicted) [Rattus norvegicus] |
| GI:23956162 | RefSeq | NP_001101291.1 | 278 | 1-acyl-sn-glycerol-3-phosphate acyltransferase beta precursor [Rattus norvegicus] |
| GI:23956162 | RefSeq | XP_005083701.1 | 278 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase beta isoform X1 [Mesocricetus auratus] |
| GI:23956162 | RefSeq | XP_005346295.1 | 277 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase beta isoform X1 [Microtus ochrogaster] |
| GI:23956162 | RefSeq | XP_006981029.1 | 278 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase beta isoform X1 [Peromyscus maniculatus bairdii] |
| GI:23956162 | RefSeq | XP_006981030.1 | 278 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase beta isoform X2 [Peromyscus maniculatus bairdii] |