Gene/Proteome Database (LMPD)
LMPD ID
LMP001964
Gene ID
Species
Homo sapiens (Human)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 1
Gene Symbol
Synonyms
1-AGPAT1; G15; LPAAT-alpha; LPAATA
Alternate Names
1-acyl-sn-glycerol-3-phosphate acyltransferase alpha; 1-AGPAT 1; 1-AGP acyltransferase 1; lysophospholipid acyltransferase; lysophosphatidic acid acyltransferase alpha; 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme A thiolase); 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, alpha)
Chromosome
6
Map Location
6p21.3
EC Number
2.3.1.51
Summary
This gene encodes an enzyme that converts lysophosphatidic acid (LPA) into phosphatidic acid (PA). LPA and PA are two phospholipids involved in signal transduction and in lipid biosynthesis in cells. This enzyme localizes to the endoplasmic reticulum. This gene is located in the class III region of the human major histocompatibility complex. Alternative splicing results in two transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha | |
|---|---|
| Refseq ID | NP_116130 |
| Protein GI | 15100175 |
| UniProt ID | Q99943 |
| mRNA ID | NM_032741 |
| Length | 283 |
| RefSeq Status | REVIEWED |
| MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILRLMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACWLAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVMSSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPGGGG | |
Gene Information
Entrez Gene ID
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | TAS:ProtInc | C | endoplasmic reticulum |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:UniProtKB | C | membrane |
| GO:0003841 | IGI:BHF-UCL | F | 1-acylglycerol-3-phosphate O-acyltransferase activity |
| GO:0016024 | IEA:UniProtKB-UniPathway | P | CDP-diacylglycerol biosynthetic process |
| GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
| GO:0006112 | TAS:Reactome | P | energy reserve metabolic process |
| GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
| GO:0006654 | IGI:BHF-UCL | P | phosphatidic acid biosynthetic process |
| GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
| GO:0031325 | TAS:Reactome | P | positive regulation of cellular metabolic process |
| GO:0001819 | IMP:BHF-UCL | P | positive regulation of cytokine production |
| GO:0001961 | IC:BHF-UCL | P | positive regulation of cytokine-mediated signaling pathway |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0019432 | TAS:Reactome | P | triglyceride biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04975 | Fat digestion and absorption |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_2122 | ChREBP activates metabolic gene expression |
| REACT_120906 | Synthesis of PA |
Domain Information
UniProt Annotations
Entry Information
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 1
Protein Entry
PLCA_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate. |
| Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. |
| Function | Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. |
| Pathway | Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3. |
| Sequence Caution | Sequence=AAB47493.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence= ; |
| Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Widely expressed. Expressed in adipose tissue and at high levels in testis and pancreas. Expressed at lower levels in tissues such as heart, brain, placenta, kidney, lung, spleen, thymus, prostate, ovary, intestine, colon, leukocyte and liver. |
Identical and Related Proteins
Unique RefSeq proteins for LMP001964 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 15100175 | RefSeq | NP_116130 | 283 | 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha |
Identical Sequences to LMP001964 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15100175 | GenBank | AIC50658.1 | 283 | AGPAT1, partial [synthetic construct] |
| GI:15100175 | RefSeq | XP_005272819.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X2 [Homo sapiens] |
| GI:15100175 | RefSeq | XP_005275131.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X2 [Homo sapiens] |
| GI:15100175 | RefSeq | XP_005275261.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X2 [Homo sapiens] |
| GI:15100175 | RefSeq | XP_005275395.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X2 [Homo sapiens] |
| GI:15100175 | RefSeq | XP_005275562.1 | 283 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X2 [Homo sapiens] |
Related Sequences to LMP001964 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:15100175 | GenBank | ADT41969.1 | 287 | Sequence 915 from patent US 7833706 |
| GI:15100175 | RefSeq | XP_001163919.2 | 287 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X1 [Pan troglodytes] |
| GI:15100175 | RefSeq | XP_004043796.1 | 287 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform 2 [Gorilla gorilla gorilla] |
| GI:15100175 | RefSeq | XP_005248862.1 | 287 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X1 [Homo sapiens] |
| GI:15100175 | RefSeq | XP_005274886.1 | 287 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X1 [Homo sapiens] |
| GI:15100175 | RefSeq | XP_005272818.1 | 287 | PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase alpha isoform X1 [Homo sapiens] |