Gene/Proteome Database (LMPD)
Proteins
| NADH dehydrogenase subunit 4L (mitochondrion) | |
|---|---|
| Refseq ID | YP_003024034 |
| Protein GI | 251831115 |
| UniProt ID | Q7GXZ4 |
| Length | 98 |
| MPLIYMNIMLAFTISLLGMLVYRSHLMSSLLCLEGMMLSLFIMATLMTLNTHSLLANIVPIAMLVFAACEAAVGLALLVSISNTYGLDYVHNLNLLQC | |
Gene Information
Entrez Gene ID
Gene Name
NADH dehydrogenase, subunit 4L (complex I)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IEA:UniProtKB-KW | C | mitochondrion |
| GO:0008137 | IEA:UniProtKB-EC | F | NADH dehydrogenase (ubiquinone) activity |
| GO:0042773 | IEA:InterPro | P | ATP synthesis coupled electron transport |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa05012 | Parkinson's disease |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001133 | NADH-ubiquinone oxidoreductase chain 4L/K |
UniProt Annotations
Entry Information
Gene Name
NADH dehydrogenase, subunit 4L (complex I)
Protein Entry
Q7GXZ4_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | NADH + ubiquinone + 5 H(+)(In) = NAD(+) + ubiquinol + 4 H(+)(Out) |
| Function | Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone |
| Similarity | Belongs to the complex I subunit 4L family |
Identical and Related Proteins
Unique RefSeq proteins for LMP001968 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 251831115 | RefSeq | YP_003024034 | 98 | NADH dehydrogenase subunit 4L (mitochondrion) |
Identical Sequences to LMP001968 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP001968 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|