Gene/Proteome Database (LMPD)

LMPD ID
LMP001976
Gene ID
2168
Species
Homo sapiens (Human)
Gene Name
fatty acid binding protein 1, liver
Gene Symbol
FABP1
Synonyms
FABPL; L-FABP
Alternate Names
fatty acid-binding protein, liver; fatty acid-binding protein 1; liver-type fatty acid-binding protein
Chromosome
2
Map Location
2p11
Summary
This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. [provided by RefSeq, Mar 2011]
Orthologs
View orthologs and multiple alignments for FABP1

Proteins

fatty acid-binding protein, liver
Refseq ID NP_001434
Protein GI 4557577
UniProt ID P07148
mRNA ID NM_001443
Length 127
RefSeq Status REVIEWED
MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI

Gene Information

Entrez Gene ID
2168
Gene Name
fatty acid binding protein 1, liver
Gene Symbol
FABP1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0045179 IEA:Ensembl C apical cortex
GO:0005829 IEA:Ensembl C cytosol
GO:0070062 IDA:UniProtKB C extracellular vesicular exosome
GO:0005654 TAS:Reactome C nucleoplasm
GO:0005782 ISS:UniProtKB C peroxisomal matrix
GO:0016209 IDA:UniProtKB F antioxidant activity
GO:0032052 IEA:Ensembl F bile acid binding
GO:0003682 IEA:Ensembl F chromatin binding
GO:0008144 IEA:Ensembl F drug binding
GO:0005504 IEA:Ensembl F fatty acid binding
GO:0005324 IEA:Ensembl F long-chain fatty acid transporter activity
GO:0005543 IEA:Ensembl F phospholipid binding
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0070301 IDA:UniProtKB P cellular response to hydrogen peroxide
GO:0071456 IDA:UniProtKB P cellular response to hypoxia
GO:0050892 IEA:Ensembl P intestinal absorption
GO:0043066 IDA:UniProtKB P negative regulation of apoptotic process
GO:0043154 IDA:UniProtKB P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:0032000 IEA:Ensembl P positive regulation of fatty acid beta-oxidation
GO:0051345 IEA:Ensembl P positive regulation of hydrolase activity
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04975 Fat digestion and absorption
hsa03320 PPAR signaling pathway

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_116145 PPARA activates gene expression

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 1, liver
Protein Entry
FABPL_HUMAN
UniProt ID
P07148
Species
Human

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates hydrophobic ligands in its interior.
Function Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport.
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP001976 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4557577 RefSeq NP_001434 127 fatty acid-binding protein, liver

Identical Sequences to LMP001976 proteins

Reference Database Accession Length Protein Name
GI:4557577 DBBJ BAI46102.1 127 fatty acid binding protein 1, liver, partial [synthetic construct]
GI:4557577 GenBank AFO05763.1 127 Sequence 401 from patent US 8216786
GI:4557577 GenBank AGA40474.1 127 Sequence 18 from patent US 8321143
GI:4557577 GenBank AHD74246.1 127 Sequence 13612 from patent US 8586006
GI:4557577 GenBank AIC48730.1 127 FABP1, partial [synthetic construct]
GI:4557577 RefSeq XP_003805902.1 127 PREDICTED: fatty acid-binding protein, liver [Pan paniscus]

Related Sequences to LMP001976 proteins

Reference Database Accession Length Protein Name
GI:4557577 GenBank AAX37108.1 128 fatty acid binding protein 1, partial [synthetic construct]
GI:4557577 PDB 2F73 149 Chain B, Crystal Structure Of Human Fatty Acid Binding Protein 1 (Fabp1)
GI:4557577 PDB 2F73 149 Chain C, Crystal Structure Of Human Fatty Acid Binding Protein 1 (Fabp1)
GI:4557577 PDB 2F73 149 Chain D, Crystal Structure Of Human Fatty Acid Binding Protein 1 (Fabp1)
GI:4557577 PDB 2F73 149 Chain E, Crystal Structure Of Human Fatty Acid Binding Protein 1 (Fabp1)
GI:4557577 PDB 2F73 149 Chain F, Crystal Structure Of Human Fatty Acid Binding Protein 1 (Fabp1)